BLASTX nr result
ID: Mentha29_contig00043887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043887 (260 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [... 165 5e-39 gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulga... 162 4e-38 ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans]... 161 8e-38 gb|AEK71891.1| hypothetical chloroplast RF2 [Tetrastigma yunnane... 160 2e-37 gb|AEK71879.1| hypothetical chloroplast RF2 [Myrothamnus flabell... 160 2e-37 gb|AEK71846.1| hypothetical chloroplast RF2 [Aextoxicon punctatum] 160 2e-37 gb|AEK71827.1| hypothetical chloroplast RF2 [Heisteria concinna] 160 2e-37 gb|AEK71532.1| hypothetical chloroplast RF2 [Ochna mossambicensis] 160 2e-37 gb|ADD30890.1| putative RF2 protein [Berberidopsis corallina] gi... 160 2e-37 gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] 159 3e-37 ref|YP_008081309.1| hypothetical chloroplast RF2 (chloroplast) [... 159 3e-37 gb|ADD30887.1| putative RF2 protein [Nerium oleander] gi|3408071... 159 3e-37 gb|EPS74500.1| hypothetical protein M569_00217, partial [Genlise... 159 4e-37 ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis]... 159 4e-37 gb|AEK78216.1| hypothetical chloroplast RF2 [Drosophyllum lusita... 159 4e-37 gb|ADD30883.1| putative RF2 protein [Ilex cornuta] gi|340806994|... 159 4e-37 prf||1211235CA ORF 1708 159 5e-37 gb|AGJ51293.1| Ycf2 (chloroplast) [Solanum carolinense] 159 5e-37 ref|YP_635682.1| Ycf2 [Solanum tuberosum] gi|108773191|ref|YP_63... 159 5e-37 ref|YP_538893.1| Ycf2 [Solanum bulbocastanum] gi|91209052|ref|YP... 159 5e-37 >ref|YP_007507155.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|459014556|ref|YP_007507174.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879785|gb|AFQ30972.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|401879806|gb|AFQ30993.1| hypothetical chloroplast RF2 (chloroplast) [Salvia miltiorrhiza] gi|573461995|emb|CCQ71664.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] gi|573462016|emb|CCQ71685.1| Ycf2 (chloroplast) [Salvia miltiorrhiza] Length = 2283 Score = 165 bits (418), Expect = 5e-39 Identities = 81/83 (97%), Positives = 82/83 (98%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 + CLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA Sbjct: 1281 KWCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 1340 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1341 GYLVRTHLLFVSRASSELQTEFE 1363 >gb|AFV61856.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] gi|410176216|gb|AFV61875.1| Ycf2 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 2261 Score = 162 bits (411), Expect = 4e-38 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 + CLPQWNL SEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA Sbjct: 1275 KWCLPQWNLRSEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 1334 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1335 GYLVRTHLLFVSRASSELQTEFE 1357 >ref|YP_008964078.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|568247135|ref|YP_008964094.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697199|gb|AHA84954.1| hypothetical chloroplast RF2 [Ajuga reptans] gi|558697206|gb|AHA84961.1| hypothetical chloroplast RF2 [Ajuga reptans] Length = 2248 Score = 161 bits (408), Expect = 8e-38 Identities = 80/83 (96%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 + CLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1262 KWCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1321 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1322 GYLVRTHLLFVSRASSELQTEFE 1344 >gb|AEK71891.1| hypothetical chloroplast RF2 [Tetrastigma yunnanense] Length = 2302 Score = 160 bits (405), Expect = 2e-37 Identities = 79/83 (95%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1299 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1358 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1359 GYLVRTHLLFVSRASSELQTEFE 1381 >gb|AEK71879.1| hypothetical chloroplast RF2 [Myrothamnus flabellifolia] Length = 2299 Score = 160 bits (405), Expect = 2e-37 Identities = 79/83 (95%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1281 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1340 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1341 GYLVRTHLLFVSRASSELQTEFE 1363 >gb|AEK71846.1| hypothetical chloroplast RF2 [Aextoxicon punctatum] Length = 2316 Score = 160 bits (405), Expect = 2e-37 Identities = 79/83 (95%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1294 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1353 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1354 GYLVRTHLLFVSRASSELQTEFE 1376 >gb|AEK71827.1| hypothetical chloroplast RF2 [Heisteria concinna] Length = 2297 Score = 160 bits (405), Expect = 2e-37 Identities = 79/83 (95%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1291 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1350 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1351 GYLVRTHLLFVSRASSELQTEFE 1373 >gb|AEK71532.1| hypothetical chloroplast RF2 [Ochna mossambicensis] Length = 2264 Score = 160 bits (405), Expect = 2e-37 Identities = 79/83 (95%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1281 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1340 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1341 GYLVRTHLLFVSRASSELQTEFE 1363 >gb|ADD30890.1| putative RF2 protein [Berberidopsis corallina] gi|340807100|gb|AEK71702.1| hypothetical chloroplast RF2 [Berberidopsis corallina] Length = 2298 Score = 160 bits (405), Expect = 2e-37 Identities = 79/83 (95%), Positives = 81/83 (97%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1292 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1351 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1352 GYLVRTHLLFVSRASSELQTEFE 1374 >gb|AGW04329.1| hypothetical chloroplast protein [Secamone afzelii] Length = 2279 Score = 159 bits (403), Expect = 3e-37 Identities = 79/82 (96%), Positives = 80/82 (97%) Frame = -3 Query: 246 MCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVAG 67 +CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVAG Sbjct: 1286 LCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVAG 1345 Query: 66 YLVRTHLLFVSRASSELQTEFE 1 YLVRTHLLFVSRASSELQTEFE Sbjct: 1346 YLVRTHLLFVSRASSELQTEFE 1367 >ref|YP_008081309.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|511348399|ref|YP_008081328.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|474452120|gb|AGI51188.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] gi|474452139|gb|AGI51207.1| hypothetical chloroplast RF2 (chloroplast) [Catharanthus roseus] Length = 2273 Score = 159 bits (403), Expect = 3e-37 Identities = 79/82 (96%), Positives = 80/82 (97%) Frame = -3 Query: 246 MCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVAG 67 +CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVAG Sbjct: 1286 LCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVAG 1345 Query: 66 YLVRTHLLFVSRASSELQTEFE 1 YLVRTHLLFVSRASSELQTEFE Sbjct: 1346 YLVRTHLLFVSRASSELQTEFE 1367 >gb|ADD30887.1| putative RF2 protein [Nerium oleander] gi|340807172|gb|AEK71765.1| hypothetical chloroplast RF2 [Nerium oleander] Length = 2278 Score = 159 bits (403), Expect = 3e-37 Identities = 79/82 (96%), Positives = 80/82 (97%) Frame = -3 Query: 246 MCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVAG 67 +CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVAG Sbjct: 1291 LCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVAG 1350 Query: 66 YLVRTHLLFVSRASSELQTEFE 1 YLVRTHLLFVSRASSELQTEFE Sbjct: 1351 YLVRTHLLFVSRASSELQTEFE 1372 >gb|EPS74500.1| hypothetical protein M569_00217, partial [Genlisea aurea] Length = 2262 Score = 159 bits (402), Expect = 4e-37 Identities = 79/83 (95%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 + CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1280 KWCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1339 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1340 GYLVRTHLLFVSRASSELQTEFE 1362 >ref|YP_007353958.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|442743025|ref|YP_007353977.1| Ycf2 protein (chloroplast) [Tectona grandis] gi|438687647|emb|CCP47174.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438687666|emb|CCP47196.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688331|emb|CCP47263.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688350|emb|CCP47285.1| ycf2 protein (chloroplast) [Tectona grandis] gi|438688455|emb|CCP47352.1| YCF2 protein (chloroplast) [Tectona grandis] gi|438688474|emb|CCP47374.1| ycf2 protein (chloroplast) [Tectona grandis] Length = 2287 Score = 159 bits (402), Expect = 4e-37 Identities = 79/83 (95%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 + CLPQWNLISEI SKCFHNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1285 KWCLPQWNLISEILSKCFHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1344 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1345 GYLVRTHLLFVSRASSELQTEFE 1367 >gb|AEK78216.1| hypothetical chloroplast RF2 [Drosophyllum lusitanicum] Length = 2287 Score = 159 bits (402), Expect = 4e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNL LSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1287 KLCLPQWNLISEISSKCLHNLFLSEEMIHRNNESPLISTHRRSPNVREFLYSILFLLLVA 1346 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1347 GYLVRTHLLFVSRASSELQTEFE 1369 >gb|ADD30883.1| putative RF2 protein [Ilex cornuta] gi|340806994|gb|AEK71615.1| hypothetical chloroplast RF2 [Ilex cornuta] Length = 2297 Score = 159 bits (402), Expect = 4e-37 Identities = 79/83 (95%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 + CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPNVREFLYSILFLLLVA Sbjct: 1294 KWCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNVREFLYSILFLLLVA 1353 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1354 GYLVRTHLLFVSRASSELQTEFE 1376 >prf||1211235CA ORF 1708 Length = 1000 Score = 159 bits (401), Expect = 5e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPN REFLYSILFLLLVA Sbjct: 717 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNAREFLYSILFLLLVA 776 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 777 GYLVRTHLLFVSRASSELQTEFE 799 >gb|AGJ51293.1| Ycf2 (chloroplast) [Solanum carolinense] Length = 2076 Score = 159 bits (401), Expect = 5e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPN REFLYSILFLLLVA Sbjct: 1291 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNAREFLYSILFLLLVA 1350 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1351 GYLVRTHLLFVSRASSELQTEFE 1373 >ref|YP_635682.1| Ycf2 [Solanum tuberosum] gi|108773191|ref|YP_635701.1| Ycf2 [Solanum tuberosum] gi|109896306|sp|Q27RY7.1|YCF2_SOLTU RecName: Full=Protein Ycf2 gi|88656846|gb|ABD47099.1| hypothetical chloroplast RF2 [Solanum tuberosum] gi|88656866|gb|ABD47119.1| hypothetical chloroplast RF2 [Solanum tuberosum] gi|329124625|gb|AEB72182.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124644|gb|AEB72201.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124712|gb|AEB72268.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] gi|329124731|gb|AEB72287.1| hypothetical chloroplast RF2 (chloroplast) [Solanum tuberosum] Length = 2278 Score = 159 bits (401), Expect = 5e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPN REFLYSILFLLLVA Sbjct: 1290 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNAREFLYSILFLLLVA 1349 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1350 GYLVRTHLLFVSRASSELQTEFE 1372 >ref|YP_538893.1| Ycf2 [Solanum bulbocastanum] gi|91209052|ref|YP_538912.1| Ycf2 [Solanum bulbocastanum] gi|109896305|sp|Q2MIC5.1|YCF2_SOLBU RecName: Full=Protein Ycf2 gi|84371938|gb|ABC56256.1| hypothetical chloroplast RF2 [Solanum bulbocastanum] gi|84371959|gb|ABC56277.1| hypothetical chloroplast RF2 [Solanum bulbocastanum] Length = 2278 Score = 159 bits (401), Expect = 5e-37 Identities = 78/83 (93%), Positives = 80/83 (96%) Frame = -3 Query: 249 RMCLPQWNLISEISSKCFHNLLLSEEMIHRNNESPLISTHPRSPNVREFLYSILFLLLVA 70 ++CLPQWNLISEISSKC HNLLLSEEMIHRNNESPLISTH RSPN REFLYSILFLLLVA Sbjct: 1290 KLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNAREFLYSILFLLLVA 1349 Query: 69 GYLVRTHLLFVSRASSELQTEFE 1 GYLVRTHLLFVSRASSELQTEFE Sbjct: 1350 GYLVRTHLLFVSRASSELQTEFE 1372