BLASTX nr result
ID: Mentha29_contig00043872
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043872 (341 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41213.1| hypothetical protein MIMGU_mgv1a000333mg [Mimulus... 85 9e-15 >gb|EYU41213.1| hypothetical protein MIMGU_mgv1a000333mg [Mimulus guttatus] Length = 1248 Score = 85.1 bits (209), Expect = 9e-15 Identities = 45/80 (56%), Positives = 57/80 (71%) Frame = +1 Query: 79 MAETEVSKEVSKMVAIEEKCGLDMSSYQDLPKPDSNGSNHHNQANDLDNSYVFVTGADGL 258 MAETEVS EVS +V IEEKC +MSS +DLPKPDSNG+ +DL+NSYVFV+G DGL Sbjct: 1 MAETEVSTEVSNVVGIEEKCLSEMSSCKDLPKPDSNGT------SDLENSYVFVSGDDGL 54 Query: 259 PDSSLDNKGVVSAGSSVPPQ 318 D ++ +K G S+ P+ Sbjct: 55 SDDTVGDKDAGGEGLSILPE 74