BLASTX nr result
ID: Mentha29_contig00043788
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043788 (233 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44612.1| hypothetical protein MIMGU_mgv1a021567mg, partial... 56 6e-06 >gb|EYU44612.1| hypothetical protein MIMGU_mgv1a021567mg, partial [Mimulus guttatus] Length = 282 Score = 55.8 bits (133), Expect = 6e-06 Identities = 34/73 (46%), Positives = 40/73 (54%), Gaps = 3/73 (4%) Frame = -2 Query: 232 CAGCERSGGRCGYDDAGEKFVCFCSDRSV-ESRTC--GGVAASEDDSPGAPTVTEFGKQG 62 C C SGG CGYD A ++FVCFC D SV +S TC G VA +E+ SP A T Sbjct: 221 CGECRSSGGGCGYDVARKQFVCFCPDESVAKSETCVAGAVAVAENYSPLAST-------- 272 Query: 61 PKAATVAPSVSAS 23 VAP+ S S Sbjct: 273 ---TVVAPAASES 282