BLASTX nr result
ID: Mentha29_contig00043550
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043550 (290 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU40814.1| hypothetical protein MIMGU_mgv1a026739mg [Mimulus... 63 4e-08 >gb|EYU40814.1| hypothetical protein MIMGU_mgv1a026739mg [Mimulus guttatus] Length = 333 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/65 (52%), Positives = 39/65 (60%), Gaps = 8/65 (12%) Frame = +3 Query: 57 MQREISISSHA--------DALPFGGDYDFAPPIYSPIFPPNHSSILDYLNDGASNFSST 212 MQREISIS H PF GDYDFA + IFPP HS +LDY NDG+ + S Sbjct: 1 MQREISISGHEWPDFSSTPAPAPFTGDYDFAALFHPSIFPPEHSPLLDYSNDGSFSSPSM 60 Query: 213 ESEEA 227 ESE+A Sbjct: 61 ESEDA 65