BLASTX nr result
ID: Mentha29_contig00043427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043427 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43052.1| hypothetical protein MIMGU_mgv1a0021231mg, partia... 96 5e-18 >gb|EYU43052.1| hypothetical protein MIMGU_mgv1a0021231mg, partial [Mimulus guttatus] Length = 703 Score = 95.9 bits (237), Expect = 5e-18 Identities = 45/66 (68%), Positives = 54/66 (81%) Frame = +2 Query: 143 MDISLPLDQIQSSYKFACSLFNPSVFKQKFRFSDQFSLRRRMCGAPTATFRYSLLDQGLR 322 M+ISLPLDQIQSSY+FACSL NPS+ KQK S+ FSL ++ C +P + FR SLLDQGL+ Sbjct: 1 MEISLPLDQIQSSYRFACSLVNPSLLKQKLPISEVFSLSKKRCRSPFSRFRCSLLDQGLK 60 Query: 323 PRPMPK 340 PRPMPK Sbjct: 61 PRPMPK 66