BLASTX nr result
ID: Mentha29_contig00043231
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043231 (573 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] 57 5e-06 ref|XP_006577376.1| PREDICTED: elicitor-responsive protein 3-lik... 55 1e-05 >emb|CAN75306.1| hypothetical protein VITISV_040403 [Vitis vinifera] Length = 826 Score = 56.6 bits (135), Expect = 5e-06 Identities = 30/55 (54%), Positives = 39/55 (70%) Frame = -1 Query: 573 ILSNLYAEQGRWKDVEKLRNLIHKKSLKKFVGYSVMN*IIVLNSCLICGRTECTF 409 ILSNLYAEQGRW DVE+LR L+ +K LKK +GYS++ L+ CL + E T+ Sbjct: 600 ILSNLYAEQGRWGDVERLRKLVDEKGLKKEMGYSMIE--AQLDFCLERRKDEKTY 652 >ref|XP_006577376.1| PREDICTED: elicitor-responsive protein 3-like [Glycine max] Length = 188 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -3 Query: 124 MKGAILEVFLVSAKGIDHAHVLGHPGYHVVVECGTQTSISK 2 MK ILE+ LV+AKGI H +++G P Y+VV+ECGTQT SK Sbjct: 1 MKTGILEILLVNAKGIAHPNLVGTPSYYVVIECGTQTQRSK 41