BLASTX nr result
ID: Mentha29_contig00043111
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043111 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38161.1| hypothetical protein MIMGU_mgv1a020688mg [Mimulus... 61 1e-07 gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial... 61 1e-07 >gb|EYU38161.1| hypothetical protein MIMGU_mgv1a020688mg [Mimulus guttatus] Length = 861 Score = 61.2 bits (147), Expect = 1e-07 Identities = 39/82 (47%), Positives = 50/82 (60%), Gaps = 6/82 (7%) Frame = +3 Query: 3 VLNISQGIDLEERRIVIHDDTSEHLRE-----CDALPSAPLARSLIFKGGPLPFRFRLLK 167 V +I QGID EERRIV H+ E + L SA LARSL+ GG + F+FRLL+ Sbjct: 485 VSDIPQGID-EERRIVFHEKIPEDKYDDPRVFSHGLESASLARSLVSNGGRMSFKFRLLR 543 Query: 168 V-LGVVDDDPLEDVFQHVNIRY 230 V L VVD +D+F+ N+RY Sbjct: 544 VLLNVVDSKSRDDIFELFNLRY 565 >gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial [Mimulus guttatus] Length = 842 Score = 61.2 bits (147), Expect = 1e-07 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 4/75 (5%) Frame = +3 Query: 18 QGIDLEERRIVIHDDTSEHLRE----CDALPSAPLARSLIFKGGPLPFRFRLLKVLGVVD 185 QGI+ ERRIV H+ ++ DAL S LARSLI +GG LPF+ RLL+VL V Sbjct: 500 QGIE-NERRIVFHERFPHYIHHPRGVIDALESTSLARSLISEGGRLPFKPRLLRVLNSVT 558 Query: 186 DDPLEDVFQHVNIRY 230 D L+D+ + VN+R+ Sbjct: 559 RDCLDDILKQVNLRF 573