BLASTX nr result
ID: Mentha29_contig00043021
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00043021 (324 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45295.1| hypothetical protein MIMGU_mgv1a002502mg [Mimulus... 72 1e-10 ref|XP_006401691.1| hypothetical protein EUTSA_v10012886mg [Eutr... 65 1e-08 ref|XP_006281523.1| hypothetical protein CARUB_v10027623mg [Caps... 64 2e-08 ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp.... 64 2e-08 dbj|BAB09731.1| EspB-like protein [Arabidopsis thaliana] 63 5e-08 ref|NP_200167.2| metal-nicotianamine transporter YSL3 [Arabidops... 63 5e-08 gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa] 61 1e-07 ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter Y... 61 2e-07 dbj|BAF48331.1| putative yellow stripe-like protein [Nicotiana t... 61 2e-07 ref|XP_004235117.1| PREDICTED: metal-nicotianamine transporter Y... 60 2e-07 ref|XP_002318472.2| hypothetical protein POPTR_0012s03180g [Popu... 60 4e-07 ref|XP_007039161.1| YELLOW STRIPE like 3 isoform 2 [Theobroma ca... 60 4e-07 ref|XP_007039160.1| YELLOW STRIPE like 3 isoform 1 [Theobroma ca... 60 4e-07 ref|XP_003602315.1| YSL transporter [Medicago truncatula] gi|355... 60 4e-07 gb|EYU19676.1| hypothetical protein MIMGU_mgv1a002464mg [Mimulus... 59 5e-07 ref|XP_006491954.1| PREDICTED: metal-nicotianamine transporter Y... 59 5e-07 ref|XP_006491948.1| PREDICTED: metal-nicotianamine transporter Y... 59 5e-07 ref|XP_006441190.1| hypothetical protein CICLE_v10019170mg [Citr... 59 5e-07 ref|XP_006441189.1| hypothetical protein CICLE_v10019170mg [Citr... 59 5e-07 gb|ABD04075.1| YSL transporter 3 [Noccaea caerulescens] 59 5e-07 >gb|EYU45295.1| hypothetical protein MIMGU_mgv1a002502mg [Mimulus guttatus] Length = 666 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/62 (56%), Positives = 41/62 (66%) Frame = +2 Query: 137 MGSNERXXXXXXXXXXXXXXXXVSDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLN 316 MGSN R DD+KR+PPW KQIT+RG+VA LFIGIIYSVV+MKLN Sbjct: 1 MGSNNRAQTMEIERDNLDEMTEQCDDLKRVPPWNKQITVRGIVASLFIGIIYSVVVMKLN 60 Query: 317 LS 322 L+ Sbjct: 61 LT 62 >ref|XP_006401691.1| hypothetical protein EUTSA_v10012886mg [Eutrema salsugineum] gi|312282711|dbj|BAJ34221.1| unnamed protein product [Thellungiella halophila] gi|557102781|gb|ESQ43144.1| hypothetical protein EUTSA_v10012886mg [Eutrema salsugineum] Length = 672 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 +DD K IPPWK QIT RG+VA LFIGIIYSV++MKLNL+ Sbjct: 30 ADDFKSIPPWKSQITFRGIVASLFIGIIYSVIVMKLNLT 68 >ref|XP_006281523.1| hypothetical protein CARUB_v10027623mg [Capsella rubella] gi|482550227|gb|EOA14421.1| hypothetical protein CARUB_v10027623mg [Capsella rubella] Length = 672 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 +DD K IPPWK QITIRG+VA L IG+IYSV++MKLNL+ Sbjct: 29 ADDFKSIPPWKSQITIRGIVASLIIGVIYSVIVMKLNLT 67 >ref|XP_002864249.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297310084|gb|EFH40508.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 +DD K IPPWK QIT+RG+VA L IGIIYSV++MKLNL+ Sbjct: 29 ADDFKSIPPWKSQITVRGIVASLIIGIIYSVIVMKLNLT 67 >dbj|BAB09731.1| EspB-like protein [Arabidopsis thaliana] Length = 669 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 209 DDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 DD K IPPWK+QIT RG+VA L IGIIYSV++MKLNL+ Sbjct: 30 DDFKSIPPWKEQITFRGIVASLIIGIIYSVIVMKLNLT 67 >ref|NP_200167.2| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|334188369|ref|NP_001190532.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|122197349|sp|Q2EF88.1|YSL3_ARATH RecName: Full=Metal-nicotianamine transporter YSL3; AltName: Full=Protein YELLOW STRIPE LIKE 3; Short=AtYSL3 gi|88043720|gb|ABD38920.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|332008992|gb|AED96375.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] gi|332008993|gb|AED96376.1| metal-nicotianamine transporter YSL3 [Arabidopsis thaliana] Length = 675 Score = 62.8 bits (151), Expect = 5e-08 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +2 Query: 209 DDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 DD K IPPWK+QIT RG+VA L IGIIYSV++MKLNL+ Sbjct: 30 DDFKSIPPWKEQITFRGIVASLIIGIIYSVIVMKLNLT 67 >gb|AFP55583.1| yellow stripe-like protein [Rosa rugosa] Length = 832 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +2 Query: 212 DMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 +M RIPPWKKQITIRG+VA + IGIIYSV++ KLNL+ Sbjct: 21 EMNRIPPWKKQITIRGLVASVVIGIIYSVIVQKLNLT 57 >ref|XP_006350625.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Solanum tuberosum] Length = 863 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 209 DDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 D++KRIPPW KQIT+RG+VA + IGIIYSV++ KLNL+ Sbjct: 24 DEVKRIPPWTKQITVRGIVASVLIGIIYSVIVTKLNLT 61 >dbj|BAF48331.1| putative yellow stripe-like protein [Nicotiana tabacum] Length = 675 Score = 60.8 bits (146), Expect = 2e-07 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 S+++KRIPPW KQIT+RG+VA + IGIIYSV++ KLNL+ Sbjct: 30 SEEVKRIPPWTKQITVRGIVASVLIGIIYSVIVTKLNLT 68 >ref|XP_004235117.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Solanum lycopersicum] Length = 896 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = +2 Query: 209 DDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 D++KRIPPW KQIT+RG+VA + IG+IYSV++ KLNL+ Sbjct: 24 DEVKRIPPWTKQITVRGIVASVLIGVIYSVIVTKLNLT 61 >ref|XP_002318472.2| hypothetical protein POPTR_0012s03180g [Populus trichocarpa] gi|566196537|ref|XP_006376676.1| hypothetical protein POPTR_0012s03180g [Populus trichocarpa] gi|566196539|ref|XP_002318482.2| transporter family protein [Populus trichocarpa] gi|550326272|gb|EEE96692.2| hypothetical protein POPTR_0012s03180g [Populus trichocarpa] gi|550326273|gb|ERP54473.1| hypothetical protein POPTR_0012s03180g [Populus trichocarpa] gi|550326274|gb|EEE96702.2| transporter family protein [Populus trichocarpa] Length = 665 Score = 59.7 bits (143), Expect = 4e-07 Identities = 26/38 (68%), Positives = 34/38 (89%) Frame = +2 Query: 209 DDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 +D+KRI PW KQIT+RG+VA + IGIIYSV++MKLNL+ Sbjct: 27 EDIKRIAPWTKQITVRGIVASIAIGIIYSVIVMKLNLT 64 >ref|XP_007039161.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] gi|590674417|ref|XP_007039162.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] gi|508776406|gb|EOY23662.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] gi|508776407|gb|EOY23663.1| YELLOW STRIPE like 3 isoform 2 [Theobroma cacao] Length = 668 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 ++D+KRI PW +QITIRG++A IGIIYSV++MKLNL+ Sbjct: 27 TEDLKRIAPWMRQITIRGLIASFLIGIIYSVIVMKLNLT 65 >ref|XP_007039160.1| YELLOW STRIPE like 3 isoform 1 [Theobroma cacao] gi|508776405|gb|EOY23661.1| YELLOW STRIPE like 3 isoform 1 [Theobroma cacao] Length = 668 Score = 59.7 bits (143), Expect = 4e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 ++D+KRI PW +QITIRG++A IGIIYSV++MKLNL+ Sbjct: 27 TEDLKRIAPWMRQITIRGLIASFLIGIIYSVIVMKLNLT 65 >ref|XP_003602315.1| YSL transporter [Medicago truncatula] gi|355491363|gb|AES72566.1| YSL transporter [Medicago truncatula] Length = 841 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/40 (60%), Positives = 35/40 (87%) Frame = +2 Query: 203 VSDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 + +++ RI PW+KQIT+RG++A L IGIIYSV++MKLNL+ Sbjct: 24 MDEELNRIAPWRKQITVRGLIASLIIGIIYSVIVMKLNLT 63 >gb|EYU19676.1| hypothetical protein MIMGU_mgv1a002464mg [Mimulus guttatus] Length = 671 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/37 (67%), Positives = 33/37 (89%) Frame = +2 Query: 212 DMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 + K IPPWK+QIT+RG+VA L IGIIYS+++MKLNL+ Sbjct: 31 ETKTIPPWKEQITVRGIVASLIIGIIYSIIVMKLNLT 67 >ref|XP_006491954.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X7 [Citrus sinensis] Length = 667 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 ++D+KRIPPW ITIRG++A + IGIIYSV++MKLNL+ Sbjct: 33 TEDVKRIPPWTNHITIRGLIASVAIGIIYSVIVMKLNLT 71 >ref|XP_006491948.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Citrus sinensis] gi|568877887|ref|XP_006491949.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Citrus sinensis] gi|568877889|ref|XP_006491950.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X3 [Citrus sinensis] gi|568877891|ref|XP_006491951.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X4 [Citrus sinensis] gi|568877893|ref|XP_006491952.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X5 [Citrus sinensis] gi|568877895|ref|XP_006491953.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X6 [Citrus sinensis] Length = 673 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 ++D+KRIPPW ITIRG++A + IGIIYSV++MKLNL+ Sbjct: 33 TEDVKRIPPWTNHITIRGLIASVAIGIIYSVIVMKLNLT 71 >ref|XP_006441190.1| hypothetical protein CICLE_v10019170mg [Citrus clementina] gi|557543452|gb|ESR54430.1| hypothetical protein CICLE_v10019170mg [Citrus clementina] Length = 673 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 ++D+KRIPPW ITIRG++A + IGIIYSV++MKLNL+ Sbjct: 33 TEDVKRIPPWTNHITIRGLIASVAIGIIYSVIVMKLNLT 71 >ref|XP_006441189.1| hypothetical protein CICLE_v10019170mg [Citrus clementina] gi|557543451|gb|ESR54429.1| hypothetical protein CICLE_v10019170mg [Citrus clementina] Length = 667 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 34/39 (87%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 ++D+KRIPPW ITIRG++A + IGIIYSV++MKLNL+ Sbjct: 33 TEDVKRIPPWTNHITIRGLIASVAIGIIYSVIVMKLNLT 71 >gb|ABD04075.1| YSL transporter 3 [Noccaea caerulescens] Length = 672 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/39 (64%), Positives = 33/39 (84%) Frame = +2 Query: 206 SDDMKRIPPWKKQITIRGMVAGLFIGIIYSVVLMKLNLS 322 +D+ + IPPWK QIT RG+VA L IG+IYSV++MKLNL+ Sbjct: 30 ADEYRSIPPWKSQITFRGIVASLIIGVIYSVIVMKLNLT 68