BLASTX nr result
ID: Mentha29_contig00042966
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042966 (261 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006490750.1| PREDICTED: pentatricopeptide repeat-containi... 70 3e-10 ref|XP_006451657.1| hypothetical protein CICLE_v10007619mg [Citr... 70 3e-10 ref|XP_007160512.1| hypothetical protein PHAVU_002G328100g [Phas... 69 9e-10 ref|XP_003524346.2| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_007160511.1| hypothetical protein PHAVU_002G328000g [Phas... 67 2e-09 ref|XP_004503293.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 emb|CBI15551.3| unnamed protein product [Vitis vinifera] 67 2e-09 ref|XP_003634283.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 gb|EPS65029.1| tetratricopeptide-like helical [Genlisea aurea] 67 3e-09 ref|XP_006290208.1| hypothetical protein CARUB_v10003899mg [Caps... 67 3e-09 ref|XP_002872815.1| pentatricopeptide repeat-containing protein ... 66 4e-09 ref|XP_003631084.1| Pentatricopeptide repeat-containing protein ... 66 6e-09 gb|ABE80149.1| Tetratricopeptide-like helical [Medicago truncatula] 66 6e-09 ref|NP_192184.1| pentatricopeptide repeat-containing protein [Ar... 65 8e-09 ref|XP_007036762.1| Tetratricopeptide repeat (TPR)-like superfam... 65 1e-08 ref|XP_003609218.1| Pentatricopeptide repeat-containing protein ... 65 1e-08 ref|XP_007151411.1| hypothetical protein PHAVU_004G044000g, part... 64 2e-08 ref|XP_006393385.1| hypothetical protein EUTSA_v10011302mg [Eutr... 64 2e-08 ref|XP_006829281.1| hypothetical protein AMTR_s00001p00272900 [A... 64 2e-08 gb|EXB70651.1| hypothetical protein L484_023837 [Morus notabilis] 64 2e-08 >ref|XP_006490750.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Citrus sinensis] Length = 778 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD NRFHHF GG C+CGDYW Sbjct: 744 AIKHISKIVGRLIILRDNNRFHHFSGGSCSCGDYW 778 >ref|XP_006451657.1| hypothetical protein CICLE_v10007619mg [Citrus clementina] gi|557554883|gb|ESR64897.1| hypothetical protein CICLE_v10007619mg [Citrus clementina] Length = 707 Score = 70.1 bits (170), Expect = 3e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD NRFHHF GG C+CGDYW Sbjct: 673 AIKHISKIVGRLIILRDNNRFHHFSGGSCSCGDYW 707 >ref|XP_007160512.1| hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris] gi|561033927|gb|ESW32506.1| hypothetical protein PHAVU_002G328100g [Phaseolus vulgaris] Length = 783 Score = 68.6 bits (166), Expect = 9e-10 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AI+H++KIVGRLIILRD NRFHHF G+C+CGDYW Sbjct: 749 AIRHISKIVGRLIILRDSNRFHHFNDGICSCGDYW 783 >ref|XP_003524346.2| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Glycine max] Length = 769 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD +RFHHF G+C+CGDYW Sbjct: 735 AIKHISKIVGRLIILRDSHRFHHFSEGICSCGDYW 769 >ref|XP_007160511.1| hypothetical protein PHAVU_002G328000g [Phaseolus vulgaris] gi|561033926|gb|ESW32505.1| hypothetical protein PHAVU_002G328000g [Phaseolus vulgaris] Length = 691 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD +RFHHF G+C+CGDYW Sbjct: 657 AIKHISKIVGRLIILRDSHRFHHFSEGICSCGDYW 691 >ref|XP_004503293.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Cicer arietinum] Length = 763 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD +RFHHF G+C+CGDYW Sbjct: 729 AIKHISKIVGRLIILRDSHRFHHFSKGICSCGDYW 763 >emb|CBI15551.3| unnamed protein product [Vitis vinifera] Length = 685 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 A+KH++KIVGRLIILRD +RFHHF GG C+CGDYW Sbjct: 651 AMKHISKIVGRLIILRDSHRFHHFNGGQCSCGDYW 685 >ref|XP_003634283.1| PREDICTED: pentatricopeptide repeat-containing protein At4g02750-like [Vitis vinifera] Length = 766 Score = 67.4 bits (163), Expect = 2e-09 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 A+KH++KIVGRLIILRD +RFHHF GG C+CGDYW Sbjct: 732 AMKHISKIVGRLIILRDSHRFHHFNGGQCSCGDYW 766 >gb|EPS65029.1| tetratricopeptide-like helical [Genlisea aurea] Length = 759 Score = 66.6 bits (161), Expect = 3e-09 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KI LI+LRDPNRFHHF+ G+CNCGDYW Sbjct: 725 AIKHVSKIKRTLIVLRDPNRFHHFQDGLCNCGDYW 759 >ref|XP_006290208.1| hypothetical protein CARUB_v10003899mg [Capsella rubella] gi|482558914|gb|EOA23106.1| hypothetical protein CARUB_v10003899mg [Capsella rubella] Length = 756 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIK+MAKI GRLIILRD NRFHHF+ G C+CGDYW Sbjct: 722 AIKYMAKITGRLIILRDNNRFHHFKDGSCSCGDYW 756 >ref|XP_002872815.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297318652|gb|EFH49074.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 776 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIK+MAK+ GRLIILRD NRFHHF+ G C+CGDYW Sbjct: 742 AIKYMAKVTGRLIILRDNNRFHHFKDGSCSCGDYW 776 >ref|XP_003631084.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355525106|gb|AET05560.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 980 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD +RFHHF G C+CGDYW Sbjct: 732 AIKHISKIVGRLIILRDSHRFHHFNEGFCSCGDYW 766 >gb|ABE80149.1| Tetratricopeptide-like helical [Medicago truncatula] Length = 766 Score = 65.9 bits (159), Expect = 6e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIKH++KIVGRLIILRD +RFHHF G C+CGDYW Sbjct: 732 AIKHISKIVGRLIILRDSHRFHHFNEGFCSCGDYW 766 >ref|NP_192184.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75213324|sp|Q9SY02.1|PP301_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g02750 gi|4263522|gb|AAD15348.1| hypothetical protein [Arabidopsis thaliana] gi|7269760|emb|CAB77760.1| hypothetical protein [Arabidopsis thaliana] gi|332656824|gb|AEE82224.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 781 Score = 65.5 bits (158), Expect = 8e-09 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIK+MA+I GRLIILRD NRFHHF+ G C+CGDYW Sbjct: 747 AIKYMARITGRLIILRDNNRFHHFKDGSCSCGDYW 781 >ref|XP_007036762.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590665507|ref|XP_007036763.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|590665511|ref|XP_007036764.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508774007|gb|EOY21263.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508774008|gb|EOY21264.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] gi|508774009|gb|EOY21265.1| Tetratricopeptide repeat (TPR)-like superfamily protein isoform 1 [Theobroma cacao] Length = 768 Score = 65.1 bits (157), Expect = 1e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIK+++KIVGRLIILRD NRFHHF G C+CGDYW Sbjct: 734 AIKYISKIVGRLIILRDSNRFHHFREGSCSCGDYW 768 >ref|XP_003609218.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355510273|gb|AES91415.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1134 Score = 64.7 bits (156), Expect = 1e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 A K+++KIVGR IILRD NRFHHF GG+C+CGDYW Sbjct: 1100 AFKYISKIVGRQIILRDSNRFHHFGGGMCSCGDYW 1134 >ref|XP_007151411.1| hypothetical protein PHAVU_004G044000g, partial [Phaseolus vulgaris] gi|561024720|gb|ESW23405.1| hypothetical protein PHAVU_004G044000g, partial [Phaseolus vulgaris] Length = 951 Score = 64.3 bits (155), Expect = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDY 160 AI+H++KIVGRLIILRD NRFHHF G+C+CGDY Sbjct: 918 AIRHISKIVGRLIILRDSNRFHHFNDGICSCGDY 951 Score = 62.8 bits (151), Expect = 5e-08 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 A KH +KIVGRLII+RD +RFHHF G+C+CGDYW Sbjct: 176 ANKHKSKIVGRLIIVRDSHRFHHFSEGICSCGDYW 210 >ref|XP_006393385.1| hypothetical protein EUTSA_v10011302mg [Eutrema salsugineum] gi|557089963|gb|ESQ30671.1| hypothetical protein EUTSA_v10011302mg [Eutrema salsugineum] Length = 650 Score = 64.3 bits (155), Expect = 2e-08 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIK MAK+ GRLIILRD NRFHHF+ G C+CGDYW Sbjct: 616 AIKCMAKVTGRLIILRDNNRFHHFKDGSCSCGDYW 650 >ref|XP_006829281.1| hypothetical protein AMTR_s00001p00272900 [Amborella trichopoda] gi|548834260|gb|ERM96697.1| hypothetical protein AMTR_s00001p00272900 [Amborella trichopoda] Length = 762 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/35 (71%), Positives = 32/35 (91%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 AIK +++I+GR +ILRD NRFHHFEGG+C+CGDYW Sbjct: 728 AIKLVSEIMGRAVILRDSNRFHHFEGGLCSCGDYW 762 >gb|EXB70651.1| hypothetical protein L484_023837 [Morus notabilis] Length = 1398 Score = 63.9 bits (154), Expect = 2e-08 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -1 Query: 261 AIKHMAKIVGRLIILRDPNRFHHFEGGVCNCGDYW 157 A K+++KIVGR I+LRD +RFHHFEGG C+CGDYW Sbjct: 1037 AFKYISKIVGRKIVLRDSHRFHHFEGGQCSCGDYW 1071