BLASTX nr result
ID: Mentha29_contig00042941
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042941 (287 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU25865.1| hypothetical protein MIMGU_mgv1a012704mg [Mimulus... 57 3e-06 gb|EYU25866.1| hypothetical protein MIMGU_mgv1a012704mg [Mimulus... 55 8e-06 >gb|EYU25865.1| hypothetical protein MIMGU_mgv1a012704mg [Mimulus guttatus] Length = 242 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = -1 Query: 104 LIFSVVMAEEQTIGNEFPRDFVGISLAEQPGKYF 3 L F M EQTIGNEFPRDFVGISLAEQP KYF Sbjct: 65 LSFYKAMGREQTIGNEFPRDFVGISLAEQPSKYF 98 >gb|EYU25866.1| hypothetical protein MIMGU_mgv1a012704mg [Mimulus guttatus] Length = 172 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -1 Query: 86 MAEEQTIGNEFPRDFVGISLAEQPGKYF 3 M EQTIGNEFPRDFVGISLAEQP KYF Sbjct: 1 MGREQTIGNEFPRDFVGISLAEQPSKYF 28