BLASTX nr result
ID: Mentha29_contig00042888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042888 (281 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45555.1| hypothetical protein MIMGU_mgv1a018032mg [Mimulus... 61 2e-07 >gb|EYU45555.1| hypothetical protein MIMGU_mgv1a018032mg [Mimulus guttatus] Length = 314 Score = 60.8 bits (146), Expect = 2e-07 Identities = 32/66 (48%), Positives = 39/66 (59%) Frame = -1 Query: 275 FNLLCQRYYGDVDVGGAEISIKKLLNGPVTAATAADGWRSMRISVINVRGERHGQLSFSY 96 FNL+CQR GD D+G + IK+LL+ P AA G R + V G+ GQLSFSY Sbjct: 80 FNLVCQRALGDKDIGEVHVPIKELLDTPAKGGAAAAGKRFVSYQVKKPSGKPKGQLSFSY 139 Query: 95 KFSGGT 78 KFS T Sbjct: 140 KFSEET 145