BLASTX nr result
ID: Mentha29_contig00042664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042664 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203562.1| hypothetical protein PRUPE_ppb014730mg, part... 57 3e-06 >ref|XP_007203562.1| hypothetical protein PRUPE_ppb014730mg, partial [Prunus persica] gi|462399093|gb|EMJ04761.1| hypothetical protein PRUPE_ppb014730mg, partial [Prunus persica] Length = 418 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 4/66 (6%) Frame = +1 Query: 7 EQVVGPENMTQRLLPLIADSDSCWKIFEDALGKEAT----PEMKVLKEKIVEKCEGLPLM 174 + +VG EN+ RLLPL +D +SCWKIFEDA+ + +++ LK +I +KC GLPL Sbjct: 347 KMMVGEENI-HRLLPL-SDPESCWKIFEDAVENDPILFYPSDLEDLKLEINQKCGGLPLA 404 Query: 175 AKMLGK 192 AKM+G+ Sbjct: 405 AKMMGQ 410