BLASTX nr result
ID: Mentha29_contig00042653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042653 (292 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006402169.1| hypothetical protein EUTSA_v10015409mg, part... 58 2e-06 ref|XP_006293129.1| hypothetical protein CARUB_v10019435mg [Caps... 58 2e-06 >ref|XP_006402169.1| hypothetical protein EUTSA_v10015409mg, partial [Eutrema salsugineum] gi|557103259|gb|ESQ43622.1| hypothetical protein EUTSA_v10015409mg, partial [Eutrema salsugineum] Length = 367 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/94 (37%), Positives = 52/94 (55%), Gaps = 3/94 (3%) Frame = +3 Query: 18 STPND-RCFGCGELGHRRTSCPRARTTRTLLNDDA--TLLECVDDFQFDIEALPPLIEEH 188 S PN RCF CGE GH +T+CP+ +T R L D+ + DD + + ++ P E+H Sbjct: 135 SQPNALRCFACGEPGHLQTACPK-QTRRGLFGDETKWDKDDAADDNEDEFDSEVP--EDH 191 Query: 189 VTGDTGPLLVIQRACFTPRSADTNPQRSQIFEST 290 GDT P L+++ C P + R+ IF+ST Sbjct: 192 HHGDTSPSLMLRHVCLAPVVLEEPWLRTNIFQST 225 >ref|XP_006293129.1| hypothetical protein CARUB_v10019435mg [Capsella rubella] gi|482561836|gb|EOA26027.1| hypothetical protein CARUB_v10019435mg [Capsella rubella] Length = 595 Score = 57.8 bits (138), Expect = 2e-06 Identities = 39/92 (42%), Positives = 52/92 (56%), Gaps = 7/92 (7%) Frame = +3 Query: 33 RCFGCGELGHRRTSCPRARTTRTLLNDDATLLECVDDFQFDIEALPPLIEEHVT----GD 200 RCF CGE GHR+T+CP +T R LL + E D+ +FD E L +EH T GD Sbjct: 459 RCFSCGENGHRQTACPN-QTRRGLLAQET---EFTDEPRFD-EYLSDSNQEHDTDCIGGD 513 Query: 201 TG---PLLVIQRACFTPRSADTNPQRSQIFES 287 TG +LV++R C PRS + R+ +F S Sbjct: 514 TGHGSQILVLRRNCLLPRSTKESWLRTSLFRS 545