BLASTX nr result
ID: Mentha29_contig00042642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042642 (257 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFA50331.1| dehydration-responsive element-binding protein 1 ... 55 1e-05 >gb|AFA50331.1| dehydration-responsive element-binding protein 1 [Manihot esculenta] Length = 219 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/48 (54%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = -2 Query: 256 DEEGIFGMGG---YMAEGMMLPPP---LYGQHEVEVDASDMPLWSYSI 131 DEE +FGM G YMAEGM+LPPP ++E DA+D+PLWS+S+ Sbjct: 172 DEEAVFGMPGLLAYMAEGMLLPPPQCVAQSGEDIETDAADVPLWSFSV 219