BLASTX nr result
ID: Mentha29_contig00042523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042523 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372175.1| hypothetical protein POPTR_0018s13530g [Popu... 56 4e-06 gb|EYU42169.1| hypothetical protein MIMGU_mgv1a018451mg [Mimulus... 55 1e-05 ref|XP_003595124.1| Disease resistance RPP8-like protein [Medica... 55 1e-05 >ref|XP_006372175.1| hypothetical protein POPTR_0018s13530g [Populus trichocarpa] gi|550318673|gb|ERP49972.1| hypothetical protein POPTR_0018s13530g [Populus trichocarpa] Length = 937 Score = 56.2 bits (134), Expect = 4e-06 Identities = 28/65 (43%), Positives = 43/65 (66%) Frame = -1 Query: 345 QMVVSDEGFQHLKFLCIQDMWNLRNVQVGDGAMKNLERIKISNCPYLETIPEEMGSMARL 166 +MV D+GF LK L + D+ NL +V +GAM NL ++ISNC L+T+PE + + L Sbjct: 827 KMVCLDKGFPQLKSLFLYDLPNLEEWEVVEGAMANLFHLEISNCTSLKTVPEGLRFITSL 886 Query: 165 RELKM 151 RE+++ Sbjct: 887 REMEI 891 >gb|EYU42169.1| hypothetical protein MIMGU_mgv1a018451mg [Mimulus guttatus] Length = 870 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/66 (36%), Positives = 42/66 (63%) Frame = -1 Query: 345 QMVVSDEGFQHLKFLCIQDMWNLRNVQVGDGAMKNLERIKISNCPYLETIPEEMGSMARL 166 QM ++ +G L L ++++ LR ++VG M +L R++I CP+L+ +P E+ M +L Sbjct: 801 QMTITRDGLPKLNVLSLRELIKLRKIRVGARGMSDLRRLEIHRCPHLDNLPGELEFMEQL 860 Query: 165 RELKMV 148 ELKM+ Sbjct: 861 GELKMI 866 >ref|XP_003595124.1| Disease resistance RPP8-like protein [Medicago truncatula] gi|355484172|gb|AES65375.1| Disease resistance RPP8-like protein [Medicago truncatula] Length = 928 Score = 55.1 bits (131), Expect = 1e-05 Identities = 27/66 (40%), Positives = 44/66 (66%) Frame = -1 Query: 348 RQMVVSDEGFQHLKFLCIQDMWNLRNVQVGDGAMKNLERIKISNCPYLETIPEEMGSMAR 169 +QMV S +GF L+ L + D+ NL +V GAM L +++ISNC LE +PEE+ ++ Sbjct: 829 KQMVCSSKGFPQLRSLVLSDLSNLEQWKVEKGAMCCLGKLEISNCTKLEVVPEEIRFVSS 888 Query: 168 LRELKM 151 L++L++ Sbjct: 889 LKDLEI 894