BLASTX nr result
ID: Mentha29_contig00042125
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042125 (204 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB66084.1| hypothetical protein L484_003885 [Morus notabilis] 57 3e-06 gb|EXB66604.1| hypothetical protein L484_024900 [Morus notabilis] 56 6e-06 >gb|EXB66084.1| hypothetical protein L484_003885 [Morus notabilis] Length = 288 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/67 (41%), Positives = 37/67 (55%) Frame = +1 Query: 4 PFTNRILYTPLPTSYKVPPVKPYNGSCDPRSLLSQFQYNMVNQGLGDDIYMCKVFPELLV 183 PFT I+ PLP YK PP+ Y+G DP L + +MV G ++I MC+ F L Sbjct: 39 PFTENIIRVPLPDKYKSPPIPLYDGRSDPDDHLEVYTGHMVLHGYPEEI-MCRAFRNHLS 97 Query: 184 DNVRTWF 204 D+ R WF Sbjct: 98 DSARRWF 104 >gb|EXB66604.1| hypothetical protein L484_024900 [Morus notabilis] Length = 147 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/67 (38%), Positives = 37/67 (55%) Frame = +1 Query: 4 PFTNRILYTPLPTSYKVPPVKPYNGSCDPRSLLSQFQYNMVNQGLGDDIYMCKVFPELLV 183 PFT I+ PLP Y+ P + PY+G DP L + +M+ G ++I MC+ F L Sbjct: 42 PFTEEIMAPPLPDKYRSPSIPPYDGRGDPDDHLEMYTGHMLLHGYTEEI-MCRAFRNHLT 100 Query: 184 DNVRTWF 204 D+ R WF Sbjct: 101 DSTRRWF 107