BLASTX nr result
ID: Mentha29_contig00042052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00042052 (293 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32693.1| hypothetical protein MIMGU_mgv1a025597mg, partial... 62 6e-08 >gb|EYU32693.1| hypothetical protein MIMGU_mgv1a025597mg, partial [Mimulus guttatus] Length = 526 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +3 Query: 162 NAYNLVQLIRDCTDNGRFSDGQQLHSHVLKSGLISNVFVSTALI 293 NAY L+ LIR CT+ G S G+QLH H+LKSG SN+F+STALI Sbjct: 4 NAYTLLHLIRSCTNGGVLSHGEQLHCHILKSGFRSNIFISTALI 47