BLASTX nr result
ID: Mentha29_contig00041973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041973 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007022757.1| Tetratricopeptide repeat (TPR)-like superfam... 65 1e-08 ref|XP_002276456.1| PREDICTED: pentatricopeptide repeat-containi... 62 6e-08 ref|XP_004143574.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-07 gb|EPS59657.1| hypothetical protein M569_15147, partial [Genlise... 59 5e-07 gb|EXB80834.1| hypothetical protein L484_020091 [Morus notabilis] 58 1e-06 ref|XP_007222047.1| hypothetical protein PRUPE_ppa003088mg [Prun... 56 5e-06 >ref|XP_007022757.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590613765|ref|XP_007022758.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|590613769|ref|XP_007022759.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508722385|gb|EOY14282.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508722386|gb|EOY14283.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] gi|508722387|gb|EOY14284.1| Tetratricopeptide repeat (TPR)-like superfamily protein, putative isoform 1 [Theobroma cacao] Length = 653 Score = 64.7 bits (156), Expect = 1e-08 Identities = 31/57 (54%), Positives = 41/57 (71%) Frame = -2 Query: 485 AAMRLEMKAKQVEKSPGKSVVQIDGKCYSFTVEDRFHMNKCEVFEILDNLVLQLKDD 315 A +RL MK V KSPG+S+VQ++GK + FTVEDR H ++ +LD+L LQLKDD Sbjct: 582 AMIRLLMKRNNVSKSPGQSLVQVNGKTHRFTVEDRSHPEGVLIYTLLDDLALQLKDD 638 >ref|XP_002276456.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial [Vitis vinifera] gi|296082485|emb|CBI21490.3| unnamed protein product [Vitis vinifera] Length = 637 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = -2 Query: 485 AAMRLEMKAKQVEKSPGKSVVQIDGKCYSFTVEDRFHMNKCEVFEILDNLVLQLKD 318 AA+R MK + KSPGKS+VQ++GK + FTVEDR H ++E L+NL LQ+K+ Sbjct: 582 AAIRTMMKCNKAMKSPGKSLVQVNGKTHEFTVEDRCHPEGLLIYETLENLALQMKE 637 >ref|XP_004143574.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Cucumis sativus] gi|449516723|ref|XP_004165396.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19191, mitochondrial-like [Cucumis sativus] Length = 651 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/65 (47%), Positives = 43/65 (66%) Frame = -2 Query: 485 AAMRLEMKAKQVEKSPGKSVVQIDGKCYSFTVEDRFHMNKCEVFEILDNLVLQLKDDRDV 306 AAMR M++ Q+ KSPGKSVVQ++G + F VEDR H + ++E L NL +Q+K Sbjct: 580 AAMRKTMRSNQMRKSPGKSVVQVNGMSHVFFVEDRSHHDSLLIYEALGNLAMQMKQ---- 635 Query: 305 EEFQS 291 +EF S Sbjct: 636 KEFSS 640 >gb|EPS59657.1| hypothetical protein M569_15147, partial [Genlisea aurea] Length = 626 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/55 (49%), Positives = 39/55 (70%) Frame = -2 Query: 485 AAMRLEMKAKQVEKSPGKSVVQIDGKCYSFTVEDRFHMNKCEVFEILDNLVLQLK 321 AA+R M++ +V KSPG S +++DG+C F EDRF + E+FE+LD LVL +K Sbjct: 571 AAVRARMRSGEVSKSPGCSWIEVDGRCRWFAAEDRFRCDGPEIFEVLDTLVLIMK 625 >gb|EXB80834.1| hypothetical protein L484_020091 [Morus notabilis] Length = 609 Score = 58.2 bits (139), Expect = 1e-06 Identities = 31/69 (44%), Positives = 45/69 (65%) Frame = -2 Query: 485 AAMRLEMKAKQVEKSPGKSVVQIDGKCYSFTVEDRFHMNKCEVFEILDNLVLQLKDDRDV 306 AA+R MK V+KS GKS+VQ++GK + F VEDR H ++E+LD+L+L LK+ D+ Sbjct: 539 AAIRKMMKCNSVKKSAGKSIVQVNGKRHVFAVEDRGHSESLCIYEMLDSLMLLLKEG-DL 597 Query: 305 EEFQS*FSH 279 E + H Sbjct: 598 SESELTLEH 606 >ref|XP_007222047.1| hypothetical protein PRUPE_ppa003088mg [Prunus persica] gi|462418983|gb|EMJ23246.1| hypothetical protein PRUPE_ppa003088mg [Prunus persica] Length = 605 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/58 (46%), Positives = 42/58 (72%) Frame = -2 Query: 485 AAMRLEMKAKQVEKSPGKSVVQIDGKCYSFTVEDRFHMNKCEVFEILDNLVLQLKDDR 312 AA+R MK K+V+K PG+S++ ++GK + FTVEDR H ++ +LD L LQLK+++ Sbjct: 538 AALRRAMKFKKVKKIPGQSLLHVNGKPHVFTVEDRGHPEGLLIYAMLDCLALQLKEEQ 595