BLASTX nr result
ID: Mentha29_contig00041942
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041942 (237 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41526.1| hypothetical protein MIMGU_mgv1a020146mg, partial... 61 1e-07 ref|XP_007226880.1| hypothetical protein PRUPE_ppa016713mg [Prun... 58 1e-06 gb|EXB55018.1| hypothetical protein L484_007349 [Morus notabilis] 57 3e-06 >gb|EYU41526.1| hypothetical protein MIMGU_mgv1a020146mg, partial [Mimulus guttatus] Length = 87 Score = 61.2 bits (147), Expect = 1e-07 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +2 Query: 68 KMRGTAKANAMRSAVVVLGALSFGYLTLRLGFKPYLEK 181 KMRGTAK NA+RSAVVV GAL+FGYLT+R+GFK ++E+ Sbjct: 6 KMRGTAKMNALRSAVVVAGALAFGYLTVRVGFKSFIEE 43 >ref|XP_007226880.1| hypothetical protein PRUPE_ppa016713mg [Prunus persica] gi|462423816|gb|EMJ28079.1| hypothetical protein PRUPE_ppa016713mg [Prunus persica] Length = 66 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +2 Query: 71 MRGTAKANAMRSAVVVLGALSFGYLTLRLGFKPYLEK 181 MR K NAMRS VVVLGAL+FGYLTL+LGF+P+LE+ Sbjct: 1 MRERTKVNAMRSGVVVLGALAFGYLTLQLGFRPFLER 37 >gb|EXB55018.1| hypothetical protein L484_007349 [Morus notabilis] Length = 64 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = +2 Query: 71 MRGTAKANAMRSAVVVLGALSFGYLTLRLGFKPYLEK 181 MR K NAMRS VVV+GA++FGYLTL LGFKP+LEK Sbjct: 1 MRDRRKMNAMRSGVVVVGAMAFGYLTLYLGFKPFLEK 37