BLASTX nr result
ID: Mentha29_contig00041935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041935 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004238744.1| PREDICTED: probable beta-1,3-galactosyltrans... 67 3e-09 ref|XP_006357231.1| PREDICTED: probable beta-1,3-galactosyltrans... 65 7e-09 gb|EYU28677.1| hypothetical protein MIMGU_mgv1a0037442mg, partia... 62 8e-08 >ref|XP_004238744.1| PREDICTED: probable beta-1,3-galactosyltransferase 19-like [Solanum lycopersicum] Length = 671 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = -2 Query: 188 EFKNISAMNFDDKALSSVGKDEYSELHKVVRDAFVVGKKWMEDLERGK--GGLQWGALSR 15 EFK IS + FD+K S K+E+SELHKVVRDAFVVGKK +D+E GK G + G +R Sbjct: 102 EFKRISGLVFDEKVFDSFDKEEFSELHKVVRDAFVVGKKLFQDIESGKVQGEVVSGTQNR 161 Query: 14 LE 9 E Sbjct: 162 TE 163 >ref|XP_006357231.1| PREDICTED: probable beta-1,3-galactosyltransferase 19-like [Solanum tuberosum] Length = 671 Score = 65.5 bits (158), Expect = 7e-09 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 2/62 (3%) Frame = -2 Query: 188 EFKNISAMNFDDKALSSVGKDEYSELHKVVRDAFVVGKKWMEDLERGK--GGLQWGALSR 15 EFK IS + FD+K S K+E+SELHKVVRDAFV GKK +D+E GK G + G +R Sbjct: 102 EFKRISGLVFDEKVFDSFDKEEFSELHKVVRDAFVAGKKLFQDIESGKVQGEVVSGTQNR 161 Query: 14 LE 9 E Sbjct: 162 TE 163 >gb|EYU28677.1| hypothetical protein MIMGU_mgv1a0037442mg, partial [Mimulus guttatus] Length = 189 Score = 62.0 bits (149), Expect = 8e-08 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -2 Query: 188 EFKNISAMNFDDKALSSVGKDEYSELHKVVRDAFVVGKKWMEDLERGK 45 EF IS + FDD A SVG DE+S+LH+VVRDAF GK +EDL+ GK Sbjct: 93 EFNRISGLIFDDNAFDSVGSDEFSQLHRVVRDAFASGKVVLEDLKSGK 140