BLASTX nr result
ID: Mentha29_contig00041874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041874 (569 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35851.1| hypothetical protein MIMGU_mgv1a011313mg [Mimulus... 58 2e-06 >gb|EYU35851.1| hypothetical protein MIMGU_mgv1a011313mg [Mimulus guttatus] Length = 286 Score = 57.8 bits (138), Expect = 2e-06 Identities = 31/65 (47%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = -2 Query: 457 AGFFILY-SIYSKNRKKPEPLTPYFSGLARFYCHLTPHPKLCHRSMSS-VTNATALESDP 284 A F IL SI R+ P+P+ Y S +YCHLT +P LC++SMSS + N T LE DP Sbjct: 50 ADFTILTTSICCNKRQPPKPVDAYLSNSKTYYCHLTMYPNLCYQSMSSKIPNPTLLEGDP 109 Query: 283 ALIFA 269 + IF+ Sbjct: 110 SPIFS 114