BLASTX nr result
ID: Mentha29_contig00041856
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041856 (254 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44138.1| hypothetical protein MIMGU_mgv1a003617mg [Mimulus... 128 9e-28 ref|XP_007217570.1| hypothetical protein PRUPE_ppa020933mg [Prun... 97 2e-18 gb|EPS65080.1| hypothetical protein M569_09698 [Genlisea aurea] 96 4e-18 ref|XP_004306124.1| PREDICTED: pentatricopeptide repeat-containi... 95 9e-18 ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-17 ref|NP_197038.1| pentatricopeptide repeat-containing protein [Ar... 92 1e-16 ref|XP_002873720.1| pentatricopeptide repeat-containing protein ... 91 1e-16 ref|XP_003618546.1| Pentatricopeptide repeat-containing protein ... 91 1e-16 ref|XP_004489421.1| PREDICTED: pentatricopeptide repeat-containi... 90 3e-16 ref|XP_002324074.2| pentatricopeptide repeat-containing family p... 90 4e-16 ref|XP_007151258.1| hypothetical protein PHAVU_004G031500g [Phas... 89 6e-16 ref|XP_004242297.1| PREDICTED: pentatricopeptide repeat-containi... 89 8e-16 ref|XP_007032614.1| Pentatricopeptide repeat (PPR) superfamily p... 88 1e-15 ref|XP_006603878.1| PREDICTED: pentatricopeptide repeat-containi... 88 1e-15 ref|XP_006465305.1| PREDICTED: putative pentatricopeptide repeat... 87 2e-15 ref|XP_006290195.1| hypothetical protein CARUB_v10003880mg [Caps... 87 2e-15 ref|XP_006427322.1| hypothetical protein CICLE_v10025000mg [Citr... 86 5e-15 ref|XP_004236458.1| PREDICTED: putative pentatricopeptide repeat... 86 5e-15 ref|XP_006341682.1| PREDICTED: putative pentatricopeptide repeat... 84 2e-14 emb|CBI36352.3| unnamed protein product [Vitis vinifera] 83 3e-14 >gb|EYU44138.1| hypothetical protein MIMGU_mgv1a003617mg [Mimulus guttatus] Length = 574 Score = 128 bits (321), Expect = 9e-28 Identities = 61/88 (69%), Positives = 77/88 (87%), Gaps = 4/88 (4%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 ADSFR+DLR+RGI+K PG+STMYINGQ+HQF+AGE+SHPQIKE+YS LDEMI +LK +GY Sbjct: 416 ADSFRKDLRDRGIRKIPGISTMYINGQVHQFSAGEKSHPQIKEIYSMLDEMIRKLKSAGY 475 Query: 72 VPDISSQII----GGNDDSNEEEKERAV 1 +PDI+SQI+ GG D + EEEKE+A+ Sbjct: 476 LPDIASQILSGGGGGVDSNEEEEKEQAL 503 >ref|XP_007217570.1| hypothetical protein PRUPE_ppa020933mg [Prunus persica] gi|462413720|gb|EMJ18769.1| hypothetical protein PRUPE_ppa020933mg [Prunus persica] Length = 633 Score = 97.4 bits (241), Expect = 2e-18 Identities = 42/78 (53%), Positives = 62/78 (79%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+DL+ RGI+K PGMS++Y+ Q+HQF+AG++SHPQ E+Y KLDEMI RL+++GY Sbjct: 474 ANSLRQDLKNRGIRKVPGMSSVYVGCQVHQFSAGDKSHPQTMEIYVKLDEMIQRLRLAGY 533 Query: 72 VPDISSQIIGGNDDSNEE 19 VP+ SQ+ G D +++ Sbjct: 534 VPNTGSQVFFGVDSRDDD 551 >gb|EPS65080.1| hypothetical protein M569_09698 [Genlisea aurea] Length = 792 Score = 96.3 bits (238), Expect = 4e-18 Identities = 44/85 (51%), Positives = 64/85 (75%), Gaps = 1/85 (1%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 ADSFR+DL RG +K PG+STM+++G++HQF+AGERSH +I+++Y L+ MI RLK +GY Sbjct: 637 ADSFRKDLESRGTRKIPGISTMFVDGEVHQFSAGERSHSRIEDIYGMLERMIPRLKQAGY 696 Query: 72 VPDISSQIIGGN-DDSNEEEKERAV 1 VPD+ S D++E+ KE A+ Sbjct: 697 VPDVDSSSSSSRIHDADEDSKECAL 721 >ref|XP_004306124.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 634 Score = 95.1 bits (235), Expect = 9e-18 Identities = 44/90 (48%), Positives = 68/90 (75%), Gaps = 6/90 (6%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+ +R+ L+ RGI+K PGMS++Y+ Q+HQF+AG++SH Q E+Y KL+EMI RLKV+GY Sbjct: 474 ANLWRQGLKNRGIRKMPGMSSVYVGDQVHQFSAGDKSHGQTAEIYMKLNEMIQRLKVAGY 533 Query: 72 VPDISSQIIGGNDDSNE------EEKERAV 1 VP+ + Q+ G+D+++E EE E+A+ Sbjct: 534 VPNTACQVFSGSDNTDESIADNLEELEQAL 563 >ref|XP_002278719.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Vitis vinifera] Length = 632 Score = 94.4 bits (233), Expect = 1e-17 Identities = 44/89 (49%), Positives = 68/89 (76%), Gaps = 5/89 (5%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+ L++RGIKK PGMS++++ GQ+HQF+AG++SHP+ +EVY+ LDEMI RL+++GY Sbjct: 473 ANSLRQVLKKRGIKKVPGMSSIHVGGQVHQFSAGDKSHPRTREVYNMLDEMIPRLRLAGY 532 Query: 72 VPDISSQIIGG-----NDDSNEEEKERAV 1 P+ + Q G +D +EEKE+A+ Sbjct: 533 APNTALQTFAGCDSLEDDLVEQEEKEQAL 561 >ref|NP_197038.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75180838|sp|Q9LXE8.1|PP386_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g15340, mitochondrial; Flags: Precursor gi|7671503|emb|CAB89344.1| putative protein [Arabidopsis thaliana] gi|332004768|gb|AED92151.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 623 Score = 91.7 bits (226), Expect = 1e-16 Identities = 40/84 (47%), Positives = 65/84 (77%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 AD R LR+RGI+K PG+S++Y+N +H+F++G+RSHP+ KE+Y KL+E+I R++ +GY Sbjct: 471 ADGLRGSLRKRGIRKIPGLSSIYVNDSVHRFSSGDRSHPRTKEIYLKLNEVIERIRSAGY 530 Query: 72 VPDISSQIIGGNDDSNEEEKERAV 1 VPD+S + + + + EEKE+A+ Sbjct: 531 VPDVSGLV--SHSEGDLEEKEQAL 552 >ref|XP_002873720.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297319557|gb|EFH49979.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 623 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/84 (51%), Positives = 62/84 (73%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 AD R LR RGI+K PG+S++Y+N +H+F++G+RSHP+ KEVY KL+E+I R++ +GY Sbjct: 471 ADGLRGSLRNRGIRKIPGLSSIYVNDSVHRFSSGDRSHPRTKEVYLKLNEVIERIRSAGY 530 Query: 72 VPDISSQIIGGNDDSNEEEKERAV 1 VPDIS + D EEKE+A+ Sbjct: 531 VPDISGLVSPSEGDL--EEKEQAL 552 >ref|XP_003618546.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355493561|gb|AES74764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 637 Score = 91.3 bits (225), Expect = 1e-16 Identities = 43/84 (51%), Positives = 64/84 (76%), Gaps = 3/84 (3%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+ L++RGIKK PGMS++Y++G++HQF AG++SH + E+Y KLDEMI RL+ +GY Sbjct: 478 ANSLRQVLKKRGIKKVPGMSSIYVDGKLHQFIAGDKSHTRTSEIYMKLDEMICRLRSAGY 537 Query: 72 VPDISSQIIGG---NDDSNEEEKE 10 VP+ S Q++ G DD +E +E Sbjct: 538 VPNTSCQVLFGCSNRDDCSESLEE 561 >ref|XP_004489421.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Cicer arietinum] Length = 635 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/84 (51%), Positives = 62/84 (73%), Gaps = 3/84 (3%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+ L+++GIKK PGMS++Y +GQ+HQF AG++SH + E+Y KLDEMI RL+ GY Sbjct: 476 ANSLRKVLKKKGIKKAPGMSSIYADGQLHQFIAGDKSHTRTSEIYMKLDEMICRLRFGGY 535 Query: 72 VPDISSQIIGG---NDDSNEEEKE 10 VP+ S Q++ G DD +E +E Sbjct: 536 VPNTSCQVLFGCSNRDDYSEALEE 559 >ref|XP_002324074.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550320120|gb|EEF04207.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 636 Score = 89.7 bits (221), Expect = 4e-16 Identities = 41/89 (46%), Positives = 65/89 (73%), Gaps = 5/89 (5%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+ L+ +GI+K PG+S++Y+ G IHQF+AG++SHP KE+Y L+ MI RL+++GY Sbjct: 477 ANSLRQILKSKGIRKVPGVSSIYVGGNIHQFSAGDKSHPLTKEIYHALNNMIQRLRLAGY 536 Query: 72 VPDISSQIIGGND-----DSNEEEKERAV 1 VP+ ++Q+ G+D EEKE+A+ Sbjct: 537 VPNTTNQVFPGSDGREGSSEEMEEKEQAL 565 >ref|XP_007151258.1| hypothetical protein PHAVU_004G031500g [Phaseolus vulgaris] gi|561024567|gb|ESW23252.1| hypothetical protein PHAVU_004G031500g [Phaseolus vulgaris] Length = 734 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/84 (47%), Positives = 64/84 (76%), Gaps = 3/84 (3%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+ L+ RGIKK PGMS++Y++GQ+H+F AG++SHP+ ++Y KLD+MI +L+++GY Sbjct: 575 ANSLRKVLKSRGIKKVPGMSSIYVDGQLHRFIAGDKSHPRTADIYMKLDDMICKLRLAGY 634 Query: 72 VPDISSQIIGG---NDDSNEEEKE 10 VP+ + Q++ G DD E +E Sbjct: 635 VPNTNCQVLFGCSNGDDCMEALEE 658 >ref|XP_004242297.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Solanum lycopersicum] Length = 632 Score = 88.6 bits (218), Expect = 8e-16 Identities = 41/89 (46%), Positives = 64/89 (71%), Gaps = 5/89 (5%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+ R LR RG+KK PG+S++Y+ GQIH F+AG++ HPQ +E+Y LDEMI +++++GY Sbjct: 473 ANYIRVVLRSRGVKKVPGISSIYVGGQIHCFSAGDKLHPQSQEIYMMLDEMIQKIRLAGY 532 Query: 72 VPDISSQIIGGNDDSN-----EEEKERAV 1 PD + Q G++D + +EEKE+A+ Sbjct: 533 APDTTCQKFSGSNDGDYYGYGQEEKEQAL 561 >ref|XP_007032614.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] gi|508711643|gb|EOY03540.1| Pentatricopeptide repeat (PPR) superfamily protein [Theobroma cacao] Length = 633 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/89 (43%), Positives = 67/89 (75%), Gaps = 5/89 (5%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A++ R L+ +GI+K PGMS+++++GQ+HQF+AG++SH + +++Y LD MI RL+ +GY Sbjct: 474 ANALRTVLKTKGIRKVPGMSSIHVDGQVHQFSAGDKSHSKTQDIYLMLDNMIQRLRSAGY 533 Query: 72 VPDISSQIIGGNDDSNE-----EEKERAV 1 VP+ +SQ+ G+D + + EEKE+A+ Sbjct: 534 VPNTASQVFSGSDGAEDNARDSEEKEQAL 562 >ref|XP_006603878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g15340, mitochondrial-like [Glycine max] Length = 706 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/84 (46%), Positives = 64/84 (76%), Gaps = 3/84 (3%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 A+S R+ L+ RGI+K PGMS++Y++GQ+H+F AG++SHP+ ++Y KLD+MI +L+++GY Sbjct: 547 ANSLRKVLKNRGIRKVPGMSSIYVDGQLHRFIAGDKSHPRTADIYMKLDDMICKLRLAGY 606 Query: 72 VPDISSQIIGG---NDDSNEEEKE 10 VP+ + Q++ G DD E +E Sbjct: 607 VPNTNCQVLFGCSNGDDCMEAFEE 630 >ref|XP_006465305.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Citrus sinensis] Length = 741 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/80 (53%), Positives = 56/80 (70%) Frame = -3 Query: 240 RRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGYVPDI 61 R+ + +RGIKK PG S + +NG +H+F AG++SHPQ KE+Y KLDEM LK GY+PDI Sbjct: 595 RQMILDRGIKKTPGCSMIEMNGVVHEFVAGDKSHPQTKEIYLKLDEMTSDLKFVGYMPDI 654 Query: 60 SSQIIGGNDDSNEEEKERAV 1 S + D EE+KERAV Sbjct: 655 SEVFL----DVGEEDKERAV 670 >ref|XP_006290195.1| hypothetical protein CARUB_v10003880mg [Capsella rubella] gi|482558901|gb|EOA23093.1| hypothetical protein CARUB_v10003880mg [Capsella rubella] Length = 624 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/84 (46%), Positives = 63/84 (75%) Frame = -3 Query: 252 ADSFRRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGY 73 AD RR LR RGI+K PG+S++Y+N +H+F++G+RSHP+ K +Y KL+E+I R++ +GY Sbjct: 472 ADGLRRSLRNRGIRKIPGLSSIYVNDSVHRFSSGDRSHPRTKVIYLKLNEVIERIRSAGY 531 Query: 72 VPDISSQIIGGNDDSNEEEKERAV 1 V D+S + + + + EEKE+A+ Sbjct: 532 VLDVSGLV--SHSEGDLEEKEQAL 553 >ref|XP_006427322.1| hypothetical protein CICLE_v10025000mg [Citrus clementina] gi|557529312|gb|ESR40562.1| hypothetical protein CICLE_v10025000mg [Citrus clementina] Length = 728 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/80 (52%), Positives = 56/80 (70%) Frame = -3 Query: 240 RRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGYVPDI 61 R+ + +RGIKK PG S + +NG +H+F AG++SHPQ KE+Y +LDEM LK GY+PDI Sbjct: 595 RQMILDRGIKKTPGCSMIEMNGVVHEFVAGDKSHPQTKEIYLQLDEMTSDLKFVGYMPDI 654 Query: 60 SSQIIGGNDDSNEEEKERAV 1 S + D EE+KERAV Sbjct: 655 SEVFL----DVGEEDKERAV 670 >ref|XP_004236458.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Solanum lycopersicum] Length = 752 Score = 85.9 bits (211), Expect = 5e-15 Identities = 42/80 (52%), Positives = 56/80 (70%) Frame = -3 Query: 240 RRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGYVPDI 61 RR + +RGIKK PG S + ++G +H+F AG++SHPQ K +YSKL E+IG LK SGYVPD Sbjct: 606 RRIMTDRGIKKTPGCSLIEMHGIVHEFVAGDQSHPQSKSIYSKLAELIGELKFSGYVPDT 665 Query: 60 SSQIIGGNDDSNEEEKERAV 1 S + D EEEKE ++ Sbjct: 666 SEVSL----DIGEEEKENSI 681 >ref|XP_006341682.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15930-like [Solanum tuberosum] Length = 752 Score = 84.0 bits (206), Expect = 2e-14 Identities = 41/80 (51%), Positives = 56/80 (70%) Frame = -3 Query: 240 RRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGYVPDI 61 RR + +RGIKK PG S + ++G +H+F AG++SHPQ K +YSKL E+IG LK SGYVPD Sbjct: 606 RRIMTDRGIKKTPGCSLIEMHGIVHEFVAGDQSHPQSKSIYSKLAELIGELKFSGYVPDT 665 Query: 60 SSQIIGGNDDSNEEEKERAV 1 S + D E+EKE ++ Sbjct: 666 SEVSL----DIGEDEKENSL 681 >emb|CBI36352.3| unnamed protein product [Vitis vinifera] Length = 605 Score = 83.2 bits (204), Expect = 3e-14 Identities = 42/80 (52%), Positives = 54/80 (67%) Frame = -3 Query: 240 RRDLRERGIKKQPGMSTMYINGQIHQFTAGERSHPQIKEVYSKLDEMIGRLKVSGYVPDI 61 R+ + +RGIKK PG S + +NG +H+F AG++ HPQ KE+YSKLDEM LK +GY PD Sbjct: 459 RKLMMDRGIKKTPGCSLIEMNGSVHEFVAGDQVHPQSKEIYSKLDEMSVDLKFAGYSPDT 518 Query: 60 SSQIIGGNDDSNEEEKERAV 1 S + D EEEKE AV Sbjct: 519 SEVFL----DIGEEEKESAV 534