BLASTX nr result
ID: Mentha29_contig00041844
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041844 (296 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003392094.1| PREDICTED: hypothetical protein LOC100640902... 62 6e-08 gb|ETX03503.1| hypothetical protein ETSY1_47025 [Candidatus Ento... 61 2e-07 ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter... 60 2e-07 ref|XP_002118246.1| predicted protein [Trichoplax adhaerens] gi|... 60 2e-07 ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [S... 60 4e-07 ref|XP_001698950.1| hypothetical protein CHLREDRAFT_155068 [Chla... 60 4e-07 ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago ... 57 3e-06 ref|XP_003850788.1| hypothetical protein MYCGRDRAFT_45585 [Zymos... 57 4e-06 gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira o... 55 8e-06 ref|XP_003614400.1| Cytochrome P450 likeTBP [Medicago truncatula... 55 8e-06 ref|XP_003614380.1| Cytochrome P450 likeTBP [Medicago truncatula... 55 8e-06 >ref|XP_003392094.1| PREDICTED: hypothetical protein LOC100640902 [Amphimedon queenslandica] Length = 52 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 182 MIERNCWGHSYCCERGEILRFTEDELLRKHLPRMFSLI 295 M++R+ WGHSY RGEIL F EDE LRKHLPRMFSLI Sbjct: 1 MVDRDSWGHSYSVVRGEILGFAEDERLRKHLPRMFSLI 38 >gb|ETX03503.1| hypothetical protein ETSY1_47025 [Candidatus Entotheonella sp. TSY1] Length = 68 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +2 Query: 182 MIERNCWGHSYCCERGEILRFTEDELLRKHLPRMFSLI 295 MIER+ WGHSY RGEIL F +DE +RKHLPRMFSLI Sbjct: 17 MIERDSWGHSYLIVRGEILGFMKDEQVRKHLPRMFSLI 54 >ref|WP_010118018.1| hypothetical protein, partial [Acinetobacter sp. P8-3-8] Length = 121 Score = 60.5 bits (145), Expect = 2e-07 Identities = 38/77 (49%), Positives = 44/77 (57%), Gaps = 4/77 (5%) Frame = -3 Query: 294 INENILGKCFRXXXXSVNLRISPLSQQYECPQQFLSIILSF-KNQQIEQQH---IPSFHA 127 INENILGKCFR RISPL+ QYECP+ L I+ S K +IE + IPS Sbjct: 3 INENILGKCFRSGPSCAGPRISPLAAQYECPRPSLLIMASVPKTNKIEPRSYSIIPS--C 60 Query: 126 FISK*HTCFKHSNLIKV 76 I CF+HSN KV Sbjct: 61 GIQAARACFEHSNFFKV 77 >ref|XP_002118246.1| predicted protein [Trichoplax adhaerens] gi|190579147|gb|EDV19249.1| predicted protein [Trichoplax adhaerens] Length = 183 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/43 (67%), Positives = 32/43 (74%) Frame = +2 Query: 167 FLNDKMIERNCWGHSYCCERGEILRFTEDELLRKHLPRMFSLI 295 F + MI R+ WGHSY RGEIL F +DE LRKHLPRMFSLI Sbjct: 71 FGTEVMINRDSWGHSYFIVRGEILGFMKDEQLRKHLPRMFSLI 113 >ref|XP_002449484.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] gi|241935327|gb|EES08472.1| hypothetical protein SORBIDRAFT_05g016450 [Sorghum bicolor] Length = 52 Score = 59.7 bits (143), Expect = 4e-07 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = +2 Query: 182 MIERNCWGHSYCCERGEILRFTEDELLRKHLPRMFSLI 295 MI R+ WGHSY RGEIL F +DE LRKHLPRMFSLI Sbjct: 1 MINRDSWGHSYFIVRGEILGFMKDEQLRKHLPRMFSLI 38 >ref|XP_001698950.1| hypothetical protein CHLREDRAFT_155068 [Chlamydomonas reinhardtii] gi|158269841|gb|EDO95983.1| predicted protein [Chlamydomonas reinhardtii] Length = 87 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -2 Query: 283 HPWQMLSQ*FVFSESKNFTSLTTIRMPPTVPFNHFIVQKP 164 +PWQMLSQ FVF +SKNFTS IRMPPT P NH+ Q P Sbjct: 7 YPWQMLSQMFVFRKSKNFTSDNGIRMPPTTPLNHYSGQSP 46 >ref|XP_003614394.1| hypothetical protein MTR_5g051130 [Medicago truncatula] gi|355515729|gb|AES97352.1| hypothetical protein MTR_5g051130 [Medicago truncatula] Length = 1337 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = -2 Query: 280 PWQMLSQ*FVFSESKNFTSLTTIRMPPTVPFNHF 179 PWQMLSQ FVF +SKNFTS IRMPPTVP NH+ Sbjct: 1193 PWQMLSQLFVFHKSKNFTSDYEIRMPPTVPVNHY 1226 >ref|XP_003850788.1| hypothetical protein MYCGRDRAFT_45585 [Zymoseptoria tritici IPO323] gi|339470667|gb|EGP85764.1| hypothetical protein MYCGRDRAFT_45585 [Zymoseptoria tritici IPO323] gi|452836062|gb|EME38013.1| hypothetical protein DOTSEDRAFT_141299 [Dothistroma septosporum NZE10] gi|452836073|gb|EME38022.1| hypothetical protein DOTSEDRAFT_116518, partial [Dothistroma septosporum NZE10] gi|453079850|gb|EMF07908.1| hypothetical protein SEPMUDRAFT_145509 [Sphaerulina musiva SO2202] Length = 61 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/38 (73%), Positives = 29/38 (76%) Frame = +2 Query: 182 MIERNCWGHSYCCERGEILRFTEDELLRKHLPRMFSLI 295 MI R+ GH Y RGEIL F EDELLRKHLPRMFSLI Sbjct: 1 MINRDSRGHPYSIVRGEILGFIEDELLRKHLPRMFSLI 38 >gb|EJK58437.1| hypothetical protein THAOC_21438 [Thalassiosira oceanica] Length = 104 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/57 (54%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +2 Query: 116 LDINAWNDGICCCSICWFLN-DKMIERNCWGHSYCCERGEILRFTEDELLRKHLPRM 283 L+I AWN+ I + L + MI R+ WG+SY RGEIL F +DELLRKHLPRM Sbjct: 3 LNILAWNNKIGLRNYFVGLRYEVMINRDSWGYSYFVVRGEILGFPKDELLRKHLPRM 59 >ref|XP_003614400.1| Cytochrome P450 likeTBP [Medicago truncatula] gi|355515735|gb|AES97358.1| Cytochrome P450 likeTBP [Medicago truncatula] Length = 656 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 280 PWQMLSQ*FVFSESKNFTSLTTIRMPPTVPFNHF 179 PWQMLSQ FVF +SKNFTS I+MPPTVP NH+ Sbjct: 496 PWQMLSQLFVFHKSKNFTSDYEIQMPPTVPVNHY 529 >ref|XP_003614380.1| Cytochrome P450 likeTBP [Medicago truncatula] gi|355515715|gb|AES97338.1| Cytochrome P450 likeTBP [Medicago truncatula] Length = 593 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -2 Query: 280 PWQMLSQ*FVFSESKNFTSLTTIRMPPTVPFNHF 179 PWQMLSQ FVF +SKNFTS I+MPPTVP NH+ Sbjct: 442 PWQMLSQLFVFHKSKNFTSDYEIQMPPTVPVNHY 475