BLASTX nr result
ID: Mentha29_contig00041843
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041843 (337 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28011.1| hypothetical protein MIMGU_mgv1a000698mg [Mimulus... 62 8e-08 ref|XP_006364301.1| PREDICTED: glycogen phosphorylase 1-like iso... 59 5e-07 ref|XP_007214555.1| hypothetical protein PRUPE_ppa000587mg [Prun... 59 5e-07 gb|ADP88921.1| starch phosphorylase [Gunnera manicata] 59 9e-07 ref|XP_007148122.1| hypothetical protein PHAVU_006G182300g [Phas... 57 2e-06 gb|EXC30569.1| Glycogen phosphorylase 1 [Morus notabilis] 57 3e-06 ref|XP_004232919.1| PREDICTED: glycogen phosphorylase 1-like [So... 57 3e-06 ref|XP_002509431.1| glycogen phosphorylase, putative [Ricinus co... 56 6e-06 >gb|EYU28011.1| hypothetical protein MIMGU_mgv1a000698mg [Mimulus guttatus] Length = 1014 Score = 62.0 bits (149), Expect = 8e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVRDGYFGFKDYFKSLCD++ED KDFYL Sbjct: 924 RMVRDGYFGFKDYFKSLCDTVEDGKDFYL 952 >ref|XP_006364301.1| PREDICTED: glycogen phosphorylase 1-like isoform X1 [Solanum tuberosum] Length = 1005 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVRDGYFGFKDYFKSLCD++ED DFYL Sbjct: 915 RMVRDGYFGFKDYFKSLCDTVEDGGDFYL 943 >ref|XP_007214555.1| hypothetical protein PRUPE_ppa000587mg [Prunus persica] gi|462410420|gb|EMJ15754.1| hypothetical protein PRUPE_ppa000587mg [Prunus persica] Length = 1086 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -2 Query: 108 LNCLFFCRMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 L C RMVRDGYFGFKDYF+SLCD+++ KDFYL Sbjct: 987 LQCARVIRMVRDGYFGFKDYFESLCDTVDGGKDFYL 1022 >gb|ADP88921.1| starch phosphorylase [Gunnera manicata] Length = 174 Score = 58.5 bits (140), Expect = 9e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVRDGYFGFKDYFKSLCD++E S DFYL Sbjct: 84 RMVRDGYFGFKDYFKSLCDTVEASNDFYL 112 >ref|XP_007148122.1| hypothetical protein PHAVU_006G182300g [Phaseolus vulgaris] gi|561021345|gb|ESW20116.1| hypothetical protein PHAVU_006G182300g [Phaseolus vulgaris] Length = 998 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVRDGYFG+KDYFKSLCD++E KDFYL Sbjct: 908 RMVRDGYFGYKDYFKSLCDTVEIGKDFYL 936 >gb|EXC30569.1| Glycogen phosphorylase 1 [Morus notabilis] Length = 892 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVRDGYFGF+DYFKSLCDS+E DFYL Sbjct: 802 RMVRDGYFGFQDYFKSLCDSVEGGNDFYL 830 >ref|XP_004232919.1| PREDICTED: glycogen phosphorylase 1-like [Solanum lycopersicum] Length = 1010 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVRDGYFG KDYFKSLCD++ED DFYL Sbjct: 920 RMVRDGYFGLKDYFKSLCDTVEDGGDFYL 948 >ref|XP_002509431.1| glycogen phosphorylase, putative [Ricinus communis] gi|223549330|gb|EEF50818.1| glycogen phosphorylase, putative [Ricinus communis] Length = 949 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/29 (79%), Positives = 27/29 (93%) Frame = -2 Query: 87 RMVRDGYFGFKDYFKSLCDSLEDSKDFYL 1 RMVR+GYFGF+DYFKSLCDS+E+ DFYL Sbjct: 859 RMVRNGYFGFEDYFKSLCDSVENGNDFYL 887