BLASTX nr result
ID: Mentha29_contig00041696
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041696 (270 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF75091.1|AC007583_27 F24B9.27 [Arabidopsis thaliana] 64 3e-08 ref|NP_172244.2| leucine-rich repeat transmembrane protein kinas... 64 3e-08 ref|NP_001184930.1| leucine-rich repeat transmembrane protein ki... 64 3e-08 gb|AAK43890.1|AF370513_1 Unknown protein [Arabidopsis thaliana] ... 64 3e-08 gb|EXB55700.1| putative LRR receptor-like serine/threonine-prote... 61 2e-07 ref|XP_007214913.1| hypothetical protein PRUPE_ppa000698mg [Prun... 60 4e-07 ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Popu... 59 5e-07 ref|XP_006348929.1| PREDICTED: probable LRR receptor-like serine... 59 7e-07 ref|XP_006306823.1| hypothetical protein CARUB_v10008366mg [Caps... 59 7e-07 ref|XP_004140247.1| PREDICTED: probable LRR receptor-like serine... 59 7e-07 ref|XP_002892411.1| hypothetical protein ARALYDRAFT_470791 [Arab... 59 7e-07 ref|XP_007132111.1| hypothetical protein PHAVU_011G067400g [Phas... 59 9e-07 ref|XP_004243241.1| PREDICTED: probable LRR receptor-like serine... 59 9e-07 ref|XP_002278131.2| PREDICTED: probable LRR receptor-like serine... 58 1e-06 emb|CBI22045.3| unnamed protein product [Vitis vinifera] 58 1e-06 emb|CAN60698.1| hypothetical protein VITISV_022626 [Vitis vinifera] 58 1e-06 ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago ... 57 2e-06 ref|XP_003628428.1| Leucine-rich repeat family protein /protein ... 57 2e-06 ref|XP_002865794.1| predicted protein [Arabidopsis lyrata subsp.... 57 2e-06 ref|XP_004491065.1| PREDICTED: probable leucine-rich repeat rece... 57 3e-06 >gb|AAF75091.1|AC007583_27 F24B9.27 [Arabidopsis thaliana] Length = 119 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+KLGK DWDF+KDPCSGEGTW Sbjct: 34 EVRALKEIGKKLGKKDWDFNKDPCSGEGTW 63 >ref|NP_172244.2| leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] gi|264664462|sp|C0LGE0.1|Y1765_ARATH RecName: Full=Probable LRR receptor-like serine/threonine-protein kinase At1g07650; Flags: Precursor gi|224589382|gb|ACN59225.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332190034|gb|AEE28155.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 1014 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+KLGK DWDF+KDPCSGEGTW Sbjct: 34 EVRALKEIGKKLGKKDWDFNKDPCSGEGTW 63 >ref|NP_001184930.1| leucine-rich repeat transmembrane protein kinase [Arabidopsis thaliana] gi|332190035|gb|AEE28156.1| putative LRR receptor-like serine/threonine-protein kinase [Arabidopsis thaliana] Length = 1020 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+KLGK DWDF+KDPCSGEGTW Sbjct: 34 EVRALKEIGKKLGKKDWDFNKDPCSGEGTW 63 >gb|AAK43890.1|AF370513_1 Unknown protein [Arabidopsis thaliana] gi|23198280|gb|AAN15667.1| Unknown protein [Arabidopsis thaliana] gi|62320689|dbj|BAD95357.1| receptor-like serine/threonine kinase [Arabidopsis thaliana] Length = 391 Score = 63.5 bits (153), Expect = 3e-08 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+KLGK DWDF+KDPCSGEGTW Sbjct: 34 EVRALKEIGKKLGKKDWDFNKDPCSGEGTW 63 >gb|EXB55700.1| putative LRR receptor-like serine/threonine-protein kinase [Morus notabilis] Length = 677 Score = 60.8 bits (146), Expect = 2e-07 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -1 Query: 96 DEVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 +EV+ L+EIGRKLGK DWDF KDPCSGEG W Sbjct: 39 EEVKVLREIGRKLGKKDWDFGKDPCSGEGNW 69 >ref|XP_007214913.1| hypothetical protein PRUPE_ppa000698mg [Prunus persica] gi|462411063|gb|EMJ16112.1| hypothetical protein PRUPE_ppa000698mg [Prunus persica] Length = 1030 Score = 59.7 bits (143), Expect = 4e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+KLGK DWDF KDPC+GEG W Sbjct: 42 EVNALKEIGKKLGKKDWDFRKDPCTGEGNW 71 >ref|XP_002306015.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa] gi|550340976|gb|EEE86526.2| hypothetical protein POPTR_0004s14310g [Populus trichocarpa] Length = 1028 Score = 59.3 bits (142), Expect = 5e-07 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 EV L+EIG+KLGK DWDF+KDPCSGEG W+ Sbjct: 42 EVRVLREIGKKLGKKDWDFNKDPCSGEGNWS 72 >ref|XP_006348929.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Solanum tuberosum] Length = 1027 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/71 (43%), Positives = 41/71 (57%) Frame = -1 Query: 213 LCVMDIEYFLSAIFLSSLYLIFXXXXXXXXXXXXXXXLQDEVEALKEIGRKLGKNDWDFS 34 + +M I + S +F SL+L+F Q+EV ALK I +K GK DWDF+ Sbjct: 1 MSIMKILFLQSLLF--SLFLVFFTVLAATSKSKLP---QEEVIALKVIAKKFGKKDWDFN 55 Query: 33 KDPCSGEGTWT 1 KDPCSGEG W+ Sbjct: 56 KDPCSGEGNWS 66 >ref|XP_006306823.1| hypothetical protein CARUB_v10008366mg [Capsella rubella] gi|482575534|gb|EOA39721.1| hypothetical protein CARUB_v10008366mg [Capsella rubella] Length = 770 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+K+GK DW+F+KDPCSGEG W Sbjct: 34 EVRALKEIGKKIGKKDWNFNKDPCSGEGNW 63 >ref|XP_004140247.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Cucumis sativus] gi|449481221|ref|XP_004156118.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Cucumis sativus] Length = 1028 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -1 Query: 99 QDEVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 ++EV+ALKEI +KLGKNDWDF+ DPCSGEG W Sbjct: 40 REEVKALKEIEKKLGKNDWDFNIDPCSGEGKW 71 >ref|XP_002892411.1| hypothetical protein ARALYDRAFT_470791 [Arabidopsis lyrata subsp. lyrata] gi|297338253|gb|EFH68670.1| hypothetical protein ARALYDRAFT_470791 [Arabidopsis lyrata subsp. lyrata] Length = 1012 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG KLGK DW+F+KDPCSGEG W Sbjct: 34 EVRALKEIGEKLGKKDWNFNKDPCSGEGNW 63 >ref|XP_007132111.1| hypothetical protein PHAVU_011G067400g [Phaseolus vulgaris] gi|561005111|gb|ESW04105.1| hypothetical protein PHAVU_011G067400g [Phaseolus vulgaris] Length = 992 Score = 58.5 bits (140), Expect = 9e-07 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -1 Query: 99 QDEVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 +DEV+ALK+IG LGK DWDFS DPCSGE WT Sbjct: 30 EDEVQALKDIGETLGKKDWDFSVDPCSGEHNWT 62 >ref|XP_004243241.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650-like [Solanum lycopersicum] Length = 1027 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 99 QDEVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 Q+EV+ALK I +K GK DWDF+KDPCSGEG W+ Sbjct: 34 QEEVKALKVIAKKFGKRDWDFNKDPCSGEGNWS 66 >ref|XP_002278131.2| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g07650 [Vitis vinifera] Length = 999 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 96 DEVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 DE++ALK IG +LGK DWDF KDPCSGEG W+ Sbjct: 28 DELKALKVIGTRLGKRDWDFGKDPCSGEGNWS 59 >emb|CBI22045.3| unnamed protein product [Vitis vinifera] Length = 1011 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 96 DEVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 DE++ALK IG +LGK DWDF KDPCSGEG W+ Sbjct: 28 DELKALKVIGTRLGKRDWDFGKDPCSGEGNWS 59 >emb|CAN60698.1| hypothetical protein VITISV_022626 [Vitis vinifera] Length = 961 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -1 Query: 96 DEVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 DE++ALK IG +LGK DWDF KDPCSGEG W+ Sbjct: 28 DELKALKVIGTRLGKRDWDFGKDPCSGEGNWS 59 >ref|XP_003628432.1| hypothetical protein MTR_8g058070 [Medicago truncatula] gi|355522454|gb|AET02908.1| hypothetical protein MTR_8g058070 [Medicago truncatula] Length = 117 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 99 QDEVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 +DEVEALK+IG+ LGK DWDFS DPCSG W Sbjct: 30 EDEVEALKDIGKTLGKKDWDFSVDPCSGRNNW 61 >ref|XP_003628428.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] gi|355522450|gb|AET02904.1| Leucine-rich repeat family protein /protein kinase family protein-like protein [Medicago truncatula] Length = 116 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -1 Query: 99 QDEVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 +DEVEALK+IG+ LGK DWDFS DPCSG W Sbjct: 30 EDEVEALKDIGKTLGKKDWDFSVDPCSGRNNW 61 >ref|XP_002865794.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297311629|gb|EFH42053.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 951 Score = 57.4 bits (137), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -1 Query: 93 EVEALKEIGRKLGKNDWDFSKDPCSGEGTW 4 EV ALKEIG+K+ K DWDFSKDPCSG+G W Sbjct: 33 EVRALKEIGKKMKKKDWDFSKDPCSGKGNW 62 >ref|XP_004491065.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein kinase At3g14840-like [Cicer arietinum] Length = 760 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/33 (72%), Positives = 26/33 (78%) Frame = -1 Query: 99 QDEVEALKEIGRKLGKNDWDFSKDPCSGEGTWT 1 +DEVEALK+I LGK DWDFS DPCSGE WT Sbjct: 30 KDEVEALKDIANTLGKKDWDFSVDPCSGEQNWT 62