BLASTX nr result
ID: Mentha29_contig00041623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00041623 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31784.1| hypothetical protein MIMGU_mgv1a003291mg [Mimulus... 74 2e-11 ref|XP_006343681.1| PREDICTED: two-component response regulator ... 69 9e-10 ref|XP_004242565.1| PREDICTED: two-component response regulator ... 64 2e-08 >gb|EYU31784.1| hypothetical protein MIMGU_mgv1a003291mg [Mimulus guttatus] Length = 594 Score = 74.3 bits (181), Expect = 2e-11 Identities = 42/77 (54%), Positives = 53/77 (68%), Gaps = 2/77 (2%) Frame = -3 Query: 314 NLDQSNDILNEKMAMYINGRSSGSG-PDLMQQNPDREVVTELRLRSNEDS-LFEQPMLQG 141 +L Q+N I N++M ++NGRSS SG +L+QQN + V ELR RSNEDS L E+ L Sbjct: 492 SLGQNNAISNQRMDGFVNGRSSVSGGSNLLQQNEIEKPVNELRQRSNEDSFLLEETRLNA 551 Query: 140 GFSPQGYDPLDELTNAL 90 GF PQ YD LDEL NA+ Sbjct: 552 GFVPQSYDSLDELVNAM 568 >ref|XP_006343681.1| PREDICTED: two-component response regulator ARR12-like [Solanum tuberosum] Length = 681 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/85 (41%), Positives = 50/85 (58%) Frame = -3 Query: 314 NLDQSNDILNEKMAMYINGRSSGSGPDLMQQNPDREVVTELRLRSNEDSLFEQPMLQGGF 135 +++QSN+ +M M + GRSSG L+QQ ++ + R RSNED L E Q GF Sbjct: 591 SMNQSNENFGRRMDMSLIGRSSGGSSTLVQQTEHEKLTLDSRTRSNEDYLLEPTKQQVGF 650 Query: 134 SPQGYDPLDELTNALTIPVDDSIME 60 SPQGYD LD+L A+ D +++ Sbjct: 651 SPQGYDSLDDLMTAMKREQDGGMLD 675 >ref|XP_004242565.1| PREDICTED: two-component response regulator ARR12-like [Solanum lycopersicum] Length = 677 Score = 63.9 bits (154), Expect = 2e-08 Identities = 32/85 (37%), Positives = 49/85 (57%) Frame = -3 Query: 314 NLDQSNDILNEKMAMYINGRSSGSGPDLMQQNPDREVVTELRLRSNEDSLFEQPMLQGGF 135 +++Q+N+ +M M + GRSSG L+Q ++ + R RSNE+ L E Q GF Sbjct: 587 SMNQNNENFGRRMDMSLIGRSSGGSSTLVQHTEHEKLTPDSRTRSNEEYLLEPTKQQVGF 646 Query: 134 SPQGYDPLDELTNALTIPVDDSIME 60 SPQGYD LD+L A+ D +++ Sbjct: 647 SPQGYDSLDDLMTAMKREQDGGMLD 671