BLASTX nr result
ID: Mentha29_contig00039934
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039934 (222 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Mimulus... 64 3e-08 gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea] 55 1e-05 >gb|EYU26768.1| hypothetical protein MIMGU_mgv1a006045mg [Mimulus guttatus] Length = 460 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/45 (62%), Positives = 34/45 (75%) Frame = -3 Query: 169 LKLDYDQVMSAWDYRKSPWMTGERPEFGSGDWWPDYFRGTGGEMH 35 L+LDYD V+S+WD RKSPW TGERP+ S + WPD GT G+MH Sbjct: 328 LRLDYDGVLSSWDERKSPWTTGERPDLDSDECWPD-CSGTCGKMH 371 >gb|EPS73837.1| hypothetical protein M569_00919 [Genlisea aurea] Length = 412 Score = 55.1 bits (131), Expect = 1e-05 Identities = 21/40 (52%), Positives = 31/40 (77%) Frame = -3 Query: 169 LKLDYDQVMSAWDYRKSPWMTGERPEFGSGDWWPDYFRGT 50 LKLD D ++SAW+ R +PW+TG++P+ S D+WPD+F T Sbjct: 300 LKLDLDGILSAWNSRNTPWITGQKPDSKSIDFWPDFFGTT 339