BLASTX nr result
ID: Mentha29_contig00039919
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039919 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528780.1| Major pollen allergen Ory s 1 precursor, put... 59 7e-07 ref|XP_002528779.1| Major pollen allergen Ory s 1 precursor, put... 57 3e-06 ref|XP_002278917.1| PREDICTED: expansin-like B1 [Vitis vinifera] 57 3e-06 >ref|XP_002528780.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] gi|223531783|gb|EEF33602.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] Length = 256 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = +1 Query: 238 LLIAALLMFESFANAAPCKDCFTQSRAAYYPNSDDKGTES 357 LL+A LL ++ A AA C DCF+QSRAA+YPNSDD+GT S Sbjct: 10 LLLATLLFMQTLAEAATCSDCFSQSRAAHYPNSDDQGTVS 49 >ref|XP_002528779.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] gi|223531782|gb|EEF33601.1| Major pollen allergen Ory s 1 precursor, putative [Ricinus communis] Length = 256 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +1 Query: 238 LLIAALLMFESFANAAPCKDCFTQSRAAYYPNSDDKGTE 354 LL A LL ++ A AA C DCFT S+AAYYPNSD++GT+ Sbjct: 10 LLFATLLFLQTLAEAATCSDCFTHSQAAYYPNSDEQGTD 48 >ref|XP_002278917.1| PREDICTED: expansin-like B1 [Vitis vinifera] Length = 255 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/49 (53%), Positives = 33/49 (67%) Frame = +1 Query: 211 MAFLQFAFNLLIAALLMFESFANAAPCKDCFTQSRAAYYPNSDDKGTES 357 MA + L+ A+ + +S A AA C DCFT SRAAYYPNSD+ GTE+ Sbjct: 1 MALPPHSLLLVFASFFLMQSLAYAATCSDCFTHSRAAYYPNSDELGTET 49