BLASTX nr result
ID: Mentha29_contig00039818
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039818 (375 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46163.1| hypothetical protein MIMGU_mgv1a011574mg [Mimulus... 73 5e-11 ref|XP_004491195.1| PREDICTED: SNF1-related protein kinase regul... 69 7e-10 emb|CAI96820.1| SNF1-related protein kinase regulatory beta subu... 69 7e-10 ref|XP_006349773.1| PREDICTED: SNF1-related protein kinase regul... 69 9e-10 ref|XP_007141557.1| hypothetical protein PHAVU_008G206100g [Phas... 69 9e-10 gb|AGZ03653.1| SnRK1 beta subunit [Solanum berthaultii] 69 9e-10 gb|AGF39570.1| beta subunit of SnRK1, partial [Solanum berthaultii] 69 9e-10 gb|AFL46501.1| transcription factor GAL83 [Capsicum annuum] 69 9e-10 gb|ABB02617.1| GAL83-like protein [Solanum tuberosum] 69 9e-10 emb|CAB52141.1| GAL83 protein [Solanum tuberosum] 69 9e-10 ref|XP_003519491.1| PREDICTED: SNF1-related protein kinase regul... 69 9e-10 gb|AAS19201.1| GAL83 [Nicotiana attenuata] 69 9e-10 gb|AFK34865.1| unknown [Lotus japonicus] 68 1e-09 ref|NP_001266255.1| SNF1 kinase complex anchoring protein [Solan... 68 1e-09 gb|ABR17472.1| unknown [Picea sitchensis] 68 1e-09 ref|XP_007016711.1| 5\'-AMP-activated protein kinase beta-2 subu... 67 2e-09 ref|XP_007016710.1| 5\'-AMP-activated protein kinase beta-2 subu... 67 2e-09 gb|EXB54662.1| SNF1-related protein kinase regulatory subunit be... 67 3e-09 gb|AFK35416.1| unknown [Medicago truncatula] 67 3e-09 ref|XP_003617137.1| SNF1-related protein kinase regulatory beta ... 67 3e-09 >gb|EYU46163.1| hypothetical protein MIMGU_mgv1a011574mg [Mimulus guttatus] Length = 277 Score = 72.8 bits (177), Expect = 5e-11 Identities = 36/39 (92%), Positives = 37/39 (94%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLFMEK +SS SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 238 VLNHLFMEKGQSSQSVVALGLTHRFQSKYVTVVLYKPLK 276 >ref|XP_004491195.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Cicer arietinum] Length = 279 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 240 VLNHVFIEKNMASKSVVALGLTHRFQSKYVTVVLYKPLK 278 >emb|CAI96820.1| SNF1-related protein kinase regulatory beta subunit 1 [Pisum sativum] Length = 279 Score = 68.9 bits (167), Expect = 7e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 240 VLNHVFIEKNMASKSVVALGLTHRFQSKYVTVVLYKPLK 278 >ref|XP_006349773.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-1-like [Solanum tuberosum] Length = 287 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 248 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 286 >ref|XP_007141557.1| hypothetical protein PHAVU_008G206100g [Phaseolus vulgaris] gi|561014690|gb|ESW13551.1| hypothetical protein PHAVU_008G206100g [Phaseolus vulgaris] Length = 284 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 245 VLNHVFIEKNLASKSVVALGLTHRFQSKYVTVVLYKPLK 283 >gb|AGZ03653.1| SnRK1 beta subunit [Solanum berthaultii] Length = 289 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 250 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 288 >gb|AGF39570.1| beta subunit of SnRK1, partial [Solanum berthaultii] Length = 285 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 241 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 279 >gb|AFL46501.1| transcription factor GAL83 [Capsicum annuum] Length = 285 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 246 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 284 >gb|ABB02617.1| GAL83-like protein [Solanum tuberosum] Length = 287 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 248 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 286 >emb|CAB52141.1| GAL83 protein [Solanum tuberosum] Length = 289 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 250 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 288 >ref|XP_003519491.1| PREDICTED: SNF1-related protein kinase regulatory subunit beta-1 [Glycine max] Length = 283 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 244 VLNHVFIEKNLASKSVVALGLTHRFQSKYVTVVLYKPLK 282 >gb|AAS19201.1| GAL83 [Nicotiana attenuata] Length = 287 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRFQSKYVTVVLYKPLK Sbjct: 248 VLNHLFIEKGWASQSVVALGLTHRFQSKYVTVVLYKPLK 286 >gb|AFK34865.1| unknown [Lotus japonicus] Length = 183 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVALG+THRFQSKYVTVVLYKPLK Sbjct: 144 VLNHVFIEKNMASKSVVALGMTHRFQSKYVTVVLYKPLK 182 >ref|NP_001266255.1| SNF1 kinase complex anchoring protein [Solanum lycopersicum] gi|348167270|gb|AEP68531.1| Gal83 [Solanum lycopersicum] Length = 289 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S S+VALGLTHRFQSKYVTVVLYKPLK Sbjct: 250 VLNHLFIEKGWASQSIVALGLTHRFQSKYVTVVLYKPLK 288 >gb|ABR17472.1| unknown [Picea sitchensis] Length = 292 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHL++ KE+SS SV+ALGLTHRF+SKYVTVVLYKPLK Sbjct: 251 VLNHLYVGKEKSSQSVLALGLTHRFRSKYVTVVLYKPLK 289 >ref|XP_007016711.1| 5\'-AMP-activated protein kinase beta-2 subunit protein isoform 2 [Theobroma cacao] gi|508787074|gb|EOY34330.1| 5\'-AMP-activated protein kinase beta-2 subunit protein isoform 2 [Theobroma cacao] Length = 292 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRF+SKYVTVVLYKPLK Sbjct: 250 VLNHLFIEKGWASQSVVALGLTHRFESKYVTVVLYKPLK 288 >ref|XP_007016710.1| 5\'-AMP-activated protein kinase beta-2 subunit protein isoform 1 [Theobroma cacao] gi|508787073|gb|EOY34329.1| 5\'-AMP-activated protein kinase beta-2 subunit protein isoform 1 [Theobroma cacao] Length = 320 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK +S SVVALGLTHRF+SKYVTVVLYKPLK Sbjct: 250 VLNHLFIEKGWASQSVVALGLTHRFESKYVTVVLYKPLK 288 >gb|EXB54662.1| SNF1-related protein kinase regulatory subunit beta-1 [Morus notabilis] Length = 313 Score = 67.0 bits (162), Expect = 3e-09 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNHLF+EK S SVVA+GLTHRFQSKYVTVVLYKPLK Sbjct: 274 VLNHLFIEKGWPSQSVVAMGLTHRFQSKYVTVVLYKPLK 312 >gb|AFK35416.1| unknown [Medicago truncatula] Length = 276 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVA+G+THRFQSKYVTVVLYKPLK Sbjct: 237 VLNHVFIEKNMASKSVVAMGVTHRFQSKYVTVVLYKPLK 275 >ref|XP_003617137.1| SNF1-related protein kinase regulatory beta subunit [Medicago truncatula] gi|355518472|gb|AET00096.1| SNF1-related protein kinase regulatory beta subunit [Medicago truncatula] Length = 158 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -1 Query: 375 VLNHLFMEKERSSPSVVALGLTHRFQSKYVTVVLYKPLK 259 VLNH+F+EK +S SVVA+G+THRFQSKYVTVVLYKPLK Sbjct: 119 VLNHVFIEKNMASKSVVAMGVTHRFQSKYVTVVLYKPLK 157