BLASTX nr result
ID: Mentha29_contig00039743
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00039743 (395 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago ... 119 2e-29 ref|XP_002518611.1| conserved hypothetical protein [Ricinus comm... 55 1e-08 >ref|XP_003588284.1| hypothetical protein MTR_1g005250 [Medicago truncatula] gi|355477332|gb|AES58535.1| hypothetical protein MTR_1g005250 [Medicago truncatula] Length = 197 Score = 119 bits (297), Expect(2) = 2e-29 Identities = 56/67 (83%), Positives = 57/67 (85%) Frame = +3 Query: 150 YDHLGLRCHDIVLWKRAGCLEARPGFFGVVGEGLTFLTHIQSYRHGPTDLFSIRASSSAT 329 YDHLGLRCHD + G LE RPGFFGVVGEGLTFLTHI SYRHGPTDLFSI ASSSAT Sbjct: 101 YDHLGLRCHDYFSMEAGGLLEVRPGFFGVVGEGLTFLTHIHSYRHGPTDLFSIGASSSAT 160 Query: 330 RFYLTKP 350 RFYLTKP Sbjct: 161 RFYLTKP 167 Score = 35.8 bits (81), Expect(2) = 2e-29 Identities = 24/52 (46%), Positives = 25/52 (48%), Gaps = 1/52 (1%) Frame = +1 Query: 1 GLVWLFFSIE-KESAVCASHLLIGSAGRHGIFVQI**IKAGRTCDGSQGFNM 153 GLVWLF SIE KESAVC AGRTCDGS N+ Sbjct: 71 GLVWLFLSIEKKESAVC----------------------AGRTCDGSPRSNI 100 >ref|XP_002518611.1| conserved hypothetical protein [Ricinus communis] gi|223542210|gb|EEF43753.1| conserved hypothetical protein [Ricinus communis] Length = 60 Score = 55.1 bits (131), Expect(2) = 1e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = +3 Query: 264 HIQSYRHGPTDLFSIRASSSATRFYLTKP 350 HIQSYRH PTDLFSI ASSS T+FYLTKP Sbjct: 2 HIQSYRHSPTDLFSIGASSSTTQFYLTKP 30 Score = 29.6 bits (65), Expect(2) = 1e-08 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = +2 Query: 353 APPRREFALPNSLF 394 A PRREFALPNSLF Sbjct: 32 AHPRREFALPNSLF 45