BLASTX nr result
ID: Mentha29_contig00038314
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00038314 (583 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006494069.1| PREDICTED: putative clathrin assembly protei... 56 8e-06 ref|XP_006432449.1| hypothetical protein CICLE_v10000680mg [Citr... 56 8e-06 >ref|XP_006494069.1| PREDICTED: putative clathrin assembly protein At1g03050-like [Citrus sinensis] Length = 583 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 112 MAPRKIKDVIGAVKDQTSIGLAKVAGSSSLSDLEVAV 2 MAP K K IGAVKD+TSIGLAKV S+SLSDLEVA+ Sbjct: 1 MAPSKFKKAIGAVKDKTSIGLAKVGSSNSLSDLEVAI 37 >ref|XP_006432449.1| hypothetical protein CICLE_v10000680mg [Citrus clementina] gi|557534571|gb|ESR45689.1| hypothetical protein CICLE_v10000680mg [Citrus clementina] Length = 583 Score = 55.8 bits (133), Expect = 8e-06 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -1 Query: 112 MAPRKIKDVIGAVKDQTSIGLAKVAGSSSLSDLEVAV 2 MAP K K IGAVKD+TSIGLAKV S+SLSDLEVA+ Sbjct: 1 MAPSKFKKAIGAVKDKTSIGLAKVGSSNSLSDLEVAI 37