BLASTX nr result
ID: Mentha29_contig00037776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037776 (391 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB36057.1| Nicotinamide mononucleotide adenylyltransferase 3... 60 2e-07 gb|EYU19647.1| hypothetical protein MIMGU_mgv1a0158002mg, partia... 59 5e-07 ref|XP_006346130.1| PREDICTED: nicotinamide mononucleotide adeny... 58 1e-06 ref|XP_004244056.1| PREDICTED: nicotinamide mononucleotide adeny... 58 1e-06 gb|AHI58946.1| nicotinamide mononucleotide adenylyltransferase 1... 55 8e-06 ref|XP_007142421.1| hypothetical protein PHAVU_008G279200g [Phas... 55 8e-06 >gb|EXB36057.1| Nicotinamide mononucleotide adenylyltransferase 3 [Morus notabilis] Length = 243 Score = 60.5 bits (145), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = +1 Query: 1 TGLRDCISRGLSVKYLTADEVIDYIKHNALYIKQNE 108 T +RDCISRGLS+KYLTADEVIDYIK N LY+ N+ Sbjct: 207 TRVRDCISRGLSIKYLTADEVIDYIKENHLYLNSND 242 >gb|EYU19647.1| hypothetical protein MIMGU_mgv1a0158002mg, partial [Mimulus guttatus] Length = 110 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +1 Query: 1 TGLRDCISRGLSVKYLTADEVIDYIKHNALYIKQ 102 TGLRDC+SRGLSVKYLT D VIDYIK N LY KQ Sbjct: 77 TGLRDCVSRGLSVKYLTEDGVIDYIKQNQLYRKQ 110 >ref|XP_006346130.1| PREDICTED: nicotinamide mononucleotide adenylyltransferase-like [Solanum tuberosum] Length = 251 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 TGLRDCISRGLSVKYLTADEVIDYIKHNALY 93 TGLRDCIS+GLSVKYLTADEVIDYIK + LY Sbjct: 218 TGLRDCISKGLSVKYLTADEVIDYIKQHNLY 248 >ref|XP_004244056.1| PREDICTED: nicotinamide mononucleotide adenylyltransferase 1-like [Solanum lycopersicum] Length = 249 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 TGLRDCISRGLSVKYLTADEVIDYIKHNALY 93 TGLRDCIS+GLSVKYLTADEVIDYIK + LY Sbjct: 216 TGLRDCISKGLSVKYLTADEVIDYIKQHNLY 246 >gb|AHI58946.1| nicotinamide mononucleotide adenylyltransferase 1 [Nicotiana tabacum] Length = 250 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 1 TGLRDCISRGLSVKYLTADEVIDYIKHNALY 93 TGLRDCIS+G SVKYLTADEVIDY+K + LY Sbjct: 213 TGLRDCISKGFSVKYLTADEVIDYMKQHNLY 243 >ref|XP_007142421.1| hypothetical protein PHAVU_008G279200g [Phaseolus vulgaris] gi|561015554|gb|ESW14415.1| hypothetical protein PHAVU_008G279200g [Phaseolus vulgaris] Length = 250 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 1 TGLRDCISRGLSVKYLTADEVIDYIKHNALYIKQNE 108 T +RDCI+RGLS+KYLTADEVIDYI+ LY+ N+ Sbjct: 214 TRVRDCIARGLSIKYLTADEVIDYIREQQLYLNLND 249