BLASTX nr result
ID: Mentha29_contig00037738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037738 (248 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38070.1| hypothetical protein MIMGU_mgv1a022647mg, partial... 40 4e-06 >gb|EYU38070.1| hypothetical protein MIMGU_mgv1a022647mg, partial [Mimulus guttatus] Length = 338 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 17/38 (44%), Positives = 30/38 (78%) Frame = +1 Query: 43 LLHECVNQLKDLAFKAKTVLETYAVKVASKKEGHNLKE 156 +LH+ + +L DLA +A+ VLE Y ++VASK++G+ +K+ Sbjct: 59 ILHDWMAELNDLASRAEDVLEKYMIEVASKRDGNLIKK 96 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +3 Query: 156 KVKRYICILCECYNVHEVGRDVRDIISRL 242 KVKR+ CIL EC VH VG+++ I S L Sbjct: 96 KVKRFSCILSECVKVHGVGKEIEAIRSSL 124