BLASTX nr result
ID: Mentha29_contig00037543
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037543 (288 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18730.1| hypothetical protein MIMGU_mgv1a000667mg [Mimulus... 58 1e-06 gb|EPS67321.1| hypothetical protein M569_07457 [Genlisea aurea] 56 4e-06 >gb|EYU18730.1| hypothetical protein MIMGU_mgv1a000667mg [Mimulus guttatus] Length = 1026 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 287 EDIFSLLVSYIALGEKNLVESVFLAANLGKTALGRLHNGDIDQWEPFF 144 E+IF LVSYI+ E N V+SV AANL KTAL +LH+GDI++W F Sbjct: 292 EEIFGSLVSYISSRENNPVDSVLFAANLAKTALAKLHDGDINEWTTNF 339 >gb|EPS67321.1| hypothetical protein M569_07457 [Genlisea aurea] Length = 532 Score = 56.2 bits (134), Expect = 4e-06 Identities = 24/49 (48%), Positives = 36/49 (73%) Frame = -2 Query: 287 EDIFSLLVSYIALGEKNLVESVFLAANLGKTALGRLHNGDIDQWEPFFP 141 E+IF LVSY++ G+ N V+++F AA L KTAL +LH+G + +W +FP Sbjct: 290 EEIFQTLVSYMSSGKGNSVDNIFPAATLSKTALAKLHDGHMKEWTTYFP 338