BLASTX nr result
ID: Mentha29_contig00037370
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037370 (280 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19057.1| hypothetical protein MIMGU_mgv1a011454mg [Mimulus... 67 3e-09 >gb|EYU19057.1| hypothetical protein MIMGU_mgv1a011454mg [Mimulus guttatus] Length = 281 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +2 Query: 140 EVERAHLNCFPEFGNIRVDAVMVKQRLHCYHLSGTLPLKFAFLGS 274 E+E AHLNCFPEFG+I V AVMVKQ+ YHLS +LPLK+AF S Sbjct: 36 ELELAHLNCFPEFGSISVTAVMVKQKSRLYHLSESLPLKYAFTSS 80