BLASTX nr result
ID: Mentha29_contig00037307
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037307 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22866.1| hypothetical protein MIMGU_mgv1a009565mg [Mimulus... 46 3e-06 >gb|EYU22866.1| hypothetical protein MIMGU_mgv1a009565mg [Mimulus guttatus] Length = 338 Score = 46.2 bits (108), Expect(2) = 3e-06 Identities = 22/43 (51%), Positives = 33/43 (76%) Frame = -2 Query: 281 SAVLTLQIGRLSKAQLRHCSDAINFFKKKMGSSETINNEFKIL 153 SAV T Q LS+ QLR CS+A+ FF++K+ S ++I++EF+IL Sbjct: 24 SAVTTTQRRALSEDQLRSCSEALKFFQQKLSSPQSIHHEFQIL 66 Score = 30.4 bits (67), Expect(2) = 3e-06 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -3 Query: 148 NRKKTLKMKNKFTISLNTLNKEKNRYPDVLP 56 +R K ++ T++L+++N KNRY +V+P Sbjct: 68 DRMKAFDARSSCTVALDSVNSSKNRYDNVIP 98