BLASTX nr result
ID: Mentha29_contig00037265
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037265 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28649.1| hypothetical protein MIMGU_mgv1a026485mg [Mimulus... 57 4e-06 >gb|EYU28649.1| hypothetical protein MIMGU_mgv1a026485mg [Mimulus guttatus] Length = 71 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -2 Query: 218 AASTGVKKVKAGATAGLHWMKTKYHKATNKH 126 AASTGVKKVKAGATAG+HW+K KY K T KH Sbjct: 41 AASTGVKKVKAGATAGIHWIKHKYQKTTQKH 71