BLASTX nr result
ID: Mentha29_contig00037013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00037013 (376 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43962.1| hypothetical protein MIMGU_mgv1a0007472mg, partia... 70 2e-10 gb|EPS59971.1| hypothetical protein M569_14833, partial [Genlise... 65 1e-08 >gb|EYU43962.1| hypothetical protein MIMGU_mgv1a0007472mg, partial [Mimulus guttatus] Length = 695 Score = 70.5 bits (171), Expect = 2e-10 Identities = 37/65 (56%), Positives = 43/65 (66%), Gaps = 2/65 (3%) Frame = -1 Query: 376 ICPRIVCNDFAPGIWESLLPLVLRHSGEKSFGFCGPLDEFDDGV--MRWMARRYKPWLMY 203 + P +VCN+FAPGI SLLPL+L C + DD V MRWMARRYKPWLMY Sbjct: 168 VSPGLVCNEFAPGICRSLLPLLL-----VDISRCDDVMVGDDDVITMRWMARRYKPWLMY 222 Query: 202 YQIMS 188 Y+IMS Sbjct: 223 YRIMS 227 >gb|EPS59971.1| hypothetical protein M569_14833, partial [Genlisea aurea] Length = 792 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 5/68 (7%) Frame = -1 Query: 376 ICPRIVCNDFAPGIWESLLPLVLRHSGEKSFG-----FCGPLDEFDDGVMRWMARRYKPW 212 + PR+V + FAPGI SL PL + H EKS L + D V++W+A+R+KPW Sbjct: 147 VFPRLVYSKFAPGICRSLFPLFIGHEDEKSSSGESLIVKAVLSDDCDEVLKWIAKRFKPW 206 Query: 211 LMYYQIMS 188 LMYYQIM+ Sbjct: 207 LMYYQIMA 214