BLASTX nr result
ID: Mentha29_contig00035837
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00035837 (482 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519871.1| PREDICTED: peptide methionine sulfoxide redu... 56 5e-06 gb|AFK45762.1| unknown [Medicago truncatula] 56 6e-06 ref|XP_003629340.1| Peptide methionine sulfoxide reductase msrA ... 56 6e-06 >ref|XP_003519871.1| PREDICTED: peptide methionine sulfoxide reductase A5-like [Glycine max] Length = 250 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/42 (64%), Positives = 33/42 (78%), Gaps = 4/42 (9%) Frame = -2 Query: 481 GYAGGSKPNPEYRSLGDHAESVQV----TVLSFSAFCDLYFS 368 GYAGGSKPNPEYRSLGDHAESV+V ++SF D+++S Sbjct: 77 GYAGGSKPNPEYRSLGDHAESVKVEYDPQLISFRELLDVFWS 118 >gb|AFK45762.1| unknown [Medicago truncatula] Length = 252 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 4/42 (9%) Frame = -2 Query: 481 GYAGGSKPNPEYRSLGDHAESVQV----TVLSFSAFCDLYFS 368 GY+GGSKPNPEYRS GDHAESVQV ++SF D+++S Sbjct: 79 GYSGGSKPNPEYRSFGDHAESVQVEYDPRLISFGELLDIFWS 120 >ref|XP_003629340.1| Peptide methionine sulfoxide reductase msrA [Medicago truncatula] gi|355523362|gb|AET03816.1| Peptide methionine sulfoxide reductase msrA [Medicago truncatula] Length = 252 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/42 (61%), Positives = 32/42 (76%), Gaps = 4/42 (9%) Frame = -2 Query: 481 GYAGGSKPNPEYRSLGDHAESVQV----TVLSFSAFCDLYFS 368 GY+GGSKPNPEYRS GDHAESVQV ++SF D+++S Sbjct: 79 GYSGGSKPNPEYRSFGDHAESVQVEYDPRLISFGELLDIFWS 120