BLASTX nr result
ID: Mentha29_contig00035284
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00035284 (279 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006389596.1| hypothetical protein POPTR_0021s00470g [Popu... 61 1e-07 ref|XP_006472380.1| PREDICTED: putative disease resistance prote... 61 2e-07 ref|XP_006433725.1| hypothetical protein CICLE_v10000073mg [Citr... 61 2e-07 ref|XP_007018351.1| Nbs-lrr resistance protein, putative [Theobr... 59 5e-07 ref|XP_002525457.1| leucine-rich repeat containing protein, puta... 57 3e-06 ref|XP_007018344.1| Nbs-lrr resistance protein, putative [Theobr... 55 8e-06 >ref|XP_006389596.1| hypothetical protein POPTR_0021s00470g [Populus trichocarpa] gi|550312425|gb|ERP48510.1| hypothetical protein POPTR_0021s00470g [Populus trichocarpa] Length = 1234 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/56 (51%), Positives = 42/56 (75%) Frame = +1 Query: 109 MAEVVISPLLQVIFEKLASPILAKFEVGKSYKKDMEKLRSTLPMIQAVIEDAETKQ 276 M +V+SPLLQ +F+KLA I+ + G Y+K+M+KL++ LP+IQ VIEDAE +Q Sbjct: 1 MDALVVSPLLQAVFDKLALLIIRELTSGGDYEKEMQKLQNRLPIIQGVIEDAEERQ 56 >ref|XP_006472380.1| PREDICTED: putative disease resistance protein RGA4-like [Citrus sinensis] Length = 1120 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/56 (50%), Positives = 44/56 (78%) Frame = +1 Query: 109 MAEVVISPLLQVIFEKLASPILAKFEVGKSYKKDMEKLRSTLPMIQAVIEDAETKQ 276 MAE+V+ PLLQVIF+K+AS +L + Y+++++KLR T+ +I+AV+EDAE +Q Sbjct: 1 MAEIVLCPLLQVIFDKVASGLLKSIALKFGYEEEIDKLRHTINLIRAVVEDAEERQ 56 >ref|XP_006433725.1| hypothetical protein CICLE_v10000073mg [Citrus clementina] gi|557535847|gb|ESR46965.1| hypothetical protein CICLE_v10000073mg [Citrus clementina] Length = 1167 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/56 (50%), Positives = 44/56 (78%) Frame = +1 Query: 109 MAEVVISPLLQVIFEKLASPILAKFEVGKSYKKDMEKLRSTLPMIQAVIEDAETKQ 276 MAE+V+ PLLQVIF+K+AS +L + Y+++++KLR T+ +I+AV+EDAE +Q Sbjct: 1 MAEIVLCPLLQVIFDKVASGLLKSIALKFGYEEEIDKLRHTINLIRAVVEDAEERQ 56 >ref|XP_007018351.1| Nbs-lrr resistance protein, putative [Theobroma cacao] gi|508723679|gb|EOY15576.1| Nbs-lrr resistance protein, putative [Theobroma cacao] Length = 1163 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/56 (51%), Positives = 43/56 (76%) Frame = +1 Query: 109 MAEVVISPLLQVIFEKLASPILAKFEVGKSYKKDMEKLRSTLPMIQAVIEDAETKQ 276 MAE+++SPLLQV+F+KLAS +L + KK++ KL+ +L +IQAV+EDAE +Q Sbjct: 1 MAEIIVSPLLQVVFDKLASRLLQEIANILGLKKEVRKLQRSLYVIQAVLEDAEERQ 56 >ref|XP_002525457.1| leucine-rich repeat containing protein, putative [Ricinus communis] gi|223535270|gb|EEF36947.1| leucine-rich repeat containing protein, putative [Ricinus communis] Length = 1177 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/56 (51%), Positives = 40/56 (71%) Frame = +1 Query: 109 MAEVVISPLLQVIFEKLASPILAKFEVGKSYKKDMEKLRSTLPMIQAVIEDAETKQ 276 MAE+V+ LQV+F+KLAS L ++ + KK++EKL STL I AV+EDAE +Q Sbjct: 1 MAEIVLIAFLQVLFDKLASSQLEEYGMWMGAKKELEKLESTLSTIAAVLEDAEDRQ 56 >ref|XP_007018344.1| Nbs-lrr resistance protein, putative [Theobroma cacao] gi|508723672|gb|EOY15569.1| Nbs-lrr resistance protein, putative [Theobroma cacao] Length = 1195 Score = 55.5 bits (132), Expect = 8e-06 Identities = 31/56 (55%), Positives = 40/56 (71%) Frame = +1 Query: 109 MAEVVISPLLQVIFEKLASPILAKFEVGKSYKKDMEKLRSTLPMIQAVIEDAETKQ 276 +A +++SPLLQVI+EKLAS E K +K +EKLR L +IQAVIEDAE +Q Sbjct: 3 VASLIVSPLLQVIYEKLAS-YPNTVETPKDQRKKIEKLRDKLQIIQAVIEDAEERQ 57