BLASTX nr result
ID: Mentha29_contig00034690
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034690 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAM36311.1| hypothetical protein [Thermobia domestica] 68 2e-09 >emb|CAM36311.1| hypothetical protein [Thermobia domestica] Length = 53 Score = 67.8 bits (164), Expect = 2e-09 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = -3 Query: 233 LIIRLSYLRDNSVILLESSY**QSLRPRCWIKIIFWCRS*FY*SVRLLIFYMI 75 +I+RLSYLRDNSVI E+SY + LRPRCWIKI+ CRS Y SVR L YMI Sbjct: 1 MIVRLSYLRDNSVIFFENSYRQERLRPRCWIKILSRCRSLVYRSVRPLKSYMI 53