BLASTX nr result
ID: Mentha29_contig00034034
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00034034 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago ... 56 6e-06 >ref|XP_003601656.1| hypothetical protein MTR_3g084030 [Medicago truncatula] gi|355490704|gb|AES71907.1| hypothetical protein MTR_3g084030 [Medicago truncatula] Length = 749 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = +2 Query: 155 SSLLAMSRCFPFPPPGFELKGRLDDVNLIIKEKEKSK 265 S AMSRCFPFPPPG+E K R DDV+L+ KE+ K K Sbjct: 24 SGFCAMSRCFPFPPPGYEKKSRTDDVDLLKKERRKEK 60