BLASTX nr result
ID: Mentha29_contig00032668
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00032668 (532 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Mimulus... 48 9e-10 >gb|EYU27043.1| hypothetical protein MIMGU_mgv1a000818mg [Mimulus guttatus] Length = 974 Score = 48.1 bits (113), Expect(2) = 9e-10 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -3 Query: 305 DSSNINEQLLKDFMPDDIYPLRVQLVAETYGHTYQL 198 +SSNI E+LLKDF+PD+I PL QLV +T G TY+L Sbjct: 778 ESSNIKEELLKDFIPDEICPLGPQLVIDTPGVTYRL 813 Score = 40.4 bits (93), Expect(2) = 9e-10 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 81 SHDCPTDSFVTRSDSCSQLILGSPCLL 1 S D PTDSF++++DSCSQL L SP LL Sbjct: 824 SDDYPTDSFISQTDSCSQLTLDSPSLL 850