BLASTX nr result
ID: Mentha29_contig00031272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031272 (494 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006365497.1| PREDICTED: methyltransferase-like protein 13... 59 9e-07 ref|XP_004230854.1| PREDICTED: endothelin-converting enzyme 2-li... 59 9e-07 >ref|XP_006365497.1| PREDICTED: methyltransferase-like protein 13-like [Solanum tuberosum] Length = 253 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 97 EIKVLEADMLQLPFEDGCFDVVIEKGTMVKLCV 195 EIKVLEADML LPFEDGCFDVVIEKGTM L V Sbjct: 104 EIKVLEADMLDLPFEDGCFDVVIEKGTMDVLFV 136 >ref|XP_004230854.1| PREDICTED: endothelin-converting enzyme 2-like [Solanum lycopersicum] Length = 253 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = +1 Query: 97 EIKVLEADMLQLPFEDGCFDVVIEKGTMVKLCV 195 EIKVLEADML LPFEDGCFDVVIEKGTM L V Sbjct: 104 EIKVLEADMLDLPFEDGCFDVVIEKGTMDVLFV 136