BLASTX nr result
ID: Mentha29_contig00031078
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031078 (398 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22306.1| hypothetical protein MIMGU_mgv1a006725mg [Mimulus... 66 4e-09 >gb|EYU22306.1| hypothetical protein MIMGU_mgv1a006725mg [Mimulus guttatus] Length = 433 Score = 66.2 bits (160), Expect = 4e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +3 Query: 3 LVPDWIYKKMAPSGDLLYNVRKVSDLNSVCEKINAI 110 LVPDWIYKK+ PSGDLLYNV+KVSD+NS+CE+++ I Sbjct: 398 LVPDWIYKKVEPSGDLLYNVKKVSDVNSICERVDGI 433