BLASTX nr result
ID: Mentha29_contig00031062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031062 (348 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19264.1| hypothetical protein MIMGU_mgv1a003604mg [Mimulus... 60 4e-07 >gb|EYU19264.1| hypothetical protein MIMGU_mgv1a003604mg [Mimulus guttatus] Length = 575 Score = 59.7 bits (143), Expect = 4e-07 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 1/74 (1%) Frame = +3 Query: 129 SQISTSPEKSSLARGTRKNRISLHEKIFKPLHHLISTST-QRNLPPYLDQNHILSSGNFY 305 S+I+ S+ RG R S HE+IFK L I +L P++D H LS GNFY Sbjct: 29 SKINHKKIISTTTRGIRSKHYSSHERIFKVLDDFICKFIINTSLSPHVDPKHELS-GNFY 87 Query: 306 PVGELPPTACEVAE 347 PV ELPPTAC+V E Sbjct: 88 PVEELPPTACQVVE 101