BLASTX nr result
ID: Mentha29_contig00031039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00031039 (639 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529263.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >ref|XP_002529263.1| conserved hypothetical protein [Ricinus communis] gi|223531252|gb|EEF33095.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/71 (40%), Positives = 45/71 (63%), Gaps = 8/71 (11%) Frame = +1 Query: 277 DPMVRFVIPNEREIGQTMRKERI--------IRFNGEGSKVRQVGELPFKAPGLKWKGAP 432 D V++ IP+ERE+ + + +I I F G+G+KV ++PFKAPGL+W+G P Sbjct: 11 DLEVKYAIPDERELRKEKQASKISNITGSRKIVFIGDGTKVSFATDMPFKAPGLQWQGNP 70 Query: 433 SITTSQLTDER 465 +TT QL ++R Sbjct: 71 CMTTRQLEEQR 81