BLASTX nr result
ID: Mentha29_contig00030810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00030810 (250 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007035467.1| Wall associated kinase-like 6, putative [The... 61 2e-07 gb|EYU28197.1| hypothetical protein MIMGU_mgv1a020454mg [Mimulus... 57 3e-06 >ref|XP_007035467.1| Wall associated kinase-like 6, putative [Theobroma cacao] gi|508714496|gb|EOY06393.1| Wall associated kinase-like 6, putative [Theobroma cacao] Length = 758 Score = 60.8 bits (146), Expect = 2e-07 Identities = 27/52 (51%), Positives = 40/52 (76%) Frame = -2 Query: 162 RMNLRFITHCVFSYLCLTITVSLAISLSKLGCPEKCGNVTIPYPFGIGSKCS 7 +M +RF++ F L LTI ++ + S++K GC ++CGNV+IPYPFGIG+KCS Sbjct: 4 KMVVRFVSSFTF-LLLLTIRLAFSASIAKNGCKDRCGNVSIPYPFGIGAKCS 54 >gb|EYU28197.1| hypothetical protein MIMGU_mgv1a020454mg [Mimulus guttatus] Length = 271 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 114 LTITVSLAISLSKLGCPEKCGNVTIPYPFGIGSKCSA 4 LT ++LA++LSK GCP CGNVTIPYPF IG CSA Sbjct: 3 LTTNLALAVTLSKDGCPSTCGNVTIPYPFCIGPSCSA 39