BLASTX nr result
ID: Mentha29_contig00030504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00030504 (955 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007046360.1| Uncharacterized protein TCM_011899 [Theobrom... 61 6e-07 gb|EYU22608.1| hypothetical protein MIMGU_mgv1a014136mg [Mimulus... 59 4e-06 >ref|XP_007046360.1| Uncharacterized protein TCM_011899 [Theobroma cacao] gi|508710295|gb|EOY02192.1| Uncharacterized protein TCM_011899 [Theobroma cacao] Length = 256 Score = 61.2 bits (147), Expect = 6e-07 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 9/60 (15%) Frame = +1 Query: 661 TVKSPPAPPTVEGTDDITPAPSPTVNLNGGISL---------DHHGLALATFLAVCGFFF 813 TV SPPAPPTV TDD TPAPSP++NLNGG SL GL +A +A+ G+ F Sbjct: 197 TVPSPPAPPTVPTTDDTTPAPSPSLNLNGGDSLFLAGGKSLWARTGLTIAILIAITGYSF 256 >gb|EYU22608.1| hypothetical protein MIMGU_mgv1a014136mg [Mimulus guttatus] Length = 199 Score = 58.5 bits (140), Expect = 4e-06 Identities = 31/59 (52%), Positives = 38/59 (64%), Gaps = 10/59 (16%) Frame = +1 Query: 661 TVKSPPAPPTVEGTDDIT-PAPSPTVNLNGGISLDHH---------GLALATFLAVCGF 807 T++SPPAPP + T + T PAPSPT+NLNG SLD GLALATFL++ F Sbjct: 139 TIQSPPAPPKAQDTGETTTPAPSPTINLNGAASLDRSGRIRMQVTAGLALATFLSITSF 197