BLASTX nr result
ID: Mentha29_contig00030422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha29_contig00030422 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31898.1| hypothetical protein MIMGU_mgv1a020883mg [Mimulus... 55 8e-06 >gb|EYU31898.1| hypothetical protein MIMGU_mgv1a020883mg [Mimulus guttatus] Length = 172 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/65 (44%), Positives = 36/65 (55%) Frame = -1 Query: 250 ISNPDAILFDSIQSFLLNDSDFPHEFYHNTPTPAAMGSGASMWAQSFEEYAAPSQEFVDD 71 +SN D IL DSIQS+LLNDSDFP EFY+ P S W Q E ++ F + Sbjct: 6 MSNSDIILLDSIQSYLLNDSDFPDEFYNPNPDSTLT---TSFWEQLSYEEVGANRHFTSE 62 Query: 70 GKQGA 56 G + A Sbjct: 63 GGENA 67